KEGG   Archaeoglobus profundus: Arcpr_0158Help
Entry
Arcpr_0158        CDS       T01152                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
apo  Archaeoglobus profundus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
133030..134067
Genome map
AA seq 345 aa AA seqDB search
MFELLKKLCDAHGISGYEDEVREIVKAELEGYVDEIKVDKLGNLICIKNGSEFKEMVCAH
MDEIGFMVKYIDEKGFIRFTPIGGWFSQIALGQRVVLHGSKGKVYGVIGCKPPHVMKDEE
RKKAIEFKDMFIDVGAESKDDVKEMGIEIGTPITIDRELVKMGNRITGKALDDRAGLAVM
IEALKRTKSDATIYAVATVQEEVGLKGARVSAFAIEPNVALALDVCVATDFPGAESTYMD
IKLGKGPAITIVDASGRGLIATKNVVKWLKETAEKNEIPYQLEVAEGGTTDATAIQLTKA
GIPSGVVSIPARYIHSPVEVVDMRDMENSANLVARALERAEKYFK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaactactcaaaaagttgtgcgacgcacacggaataagtggttacgaagatgag
gtcagagagatagtcaaagcagagcttgagggctacgtcgatgagataaaggtcgacaag
ctcgggaaccttatttgcatcaagaacggtagcgaattcaaggagatggtttgtgcgcac
atggatgagatcggttttatggtgaaatacatagacgagaagggtttcataaggtttaca
ccgataggtgggtggttcagtcaaatagctttgggacagagggtagttctgcacggaagc
aaggggaaggtctacggagttataggatgcaaacctcctcacgttatgaaagatgaggaa
agaaagaaggcgatagagtttaaggatatgttcattgacgtaggagcggagagcaaggat
gatgtaaaagagatgggcattgagattggaactccgataaccattgatagagaacttgta
aagatgggtaacaggataactggaaaggctttggatgacagagcaggtttggctgtaatg
atagaggctttaaagaggactaagagcgatgcaacaatttatgccgtagctacagttcag
gaggaggtcggtttgaagggtgcgagagtttcagcatttgcgattgagccaaatgtagct
ttagcattggatgtatgcgttgccacagattttcccggtgcggagtcaacttacatggat
ataaagcttggaaaggggccagctataacaatagttgatgcaagtggtaggggtctgatt
gcaacaaagaatgtcgtaaagtggttgaaggaaactgctgagaagaacgagataccctat
cagcttgaagttgctgaaggtggaacaacggatgcaacggcaattcagctcacgaaagct
ggaattccatctggtgtggttagtatacctgcgaggtacatccacagcccagttgaagtt
gttgatatgagagatatggagaattcagccaatttagttgcaagagcccttgaaagagct
gagaaatacttcaagtag

DBGET integrated database retrieval system