KEGG   Archaeoglobus profundus: Arcpr_0205Help
Entry
Arcpr_0205        CDS       T01152                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
apo  Archaeoglobus profundus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arcpr_0205
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arcpr_0205
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Arcpr_0205
Enzymes [BR:apo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Arcpr_0205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(173616..174371)
Genome map
AA seq 251 aa AA seqDB search
MIQKPSLITYITAGDPNVDATLEFLEILSKYSEIIELGIPFSDPMADGKTIEKSHYRALK
AGTKVKDVFRVIEEFKDNHRTPIVLMTYYNPVFVRGLDNFIGTAKDSGVDAMLVVDLPIE
EADDYLSVCEKYDMKTVFLASPNTPNDRLKAIDEASSGFVYLISLYGTTGARDRISSLAF
DLVKRARGVCVKPLAVGFGVSKAEHVRELLKAGADGVVVGSAIVKLIEEFGEKAGDKIEE
KCRELRKGLYY
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgattcaaaaaccctctctaataacgtatattacagcaggagacccgaacgttgatgca
actttagaattcctcgaaattctttccaaatacagtgagataattgagttgggaattccc
ttcagcgatccgatggctgacggtaaaacgattgaaaaatctcattacagggctttgaag
gctggaactaaggtgaaagatgtttttagggttattgaagagttcaaagacaaccatagg
actccgatagtcctcatgacatactacaatcccgtatttgtaagggggttggataatttt
attggaactgccaaagatagcggtgtggatgctatgctcgtcgttgatttgcctatagag
gaagctgacgattatttgagtgtttgcgaaaaatacgatatgaaaacagtctttttggct
tctccaaatactccaaacgataggcttaaggctatagatgaagcaagctctggcttcgtt
tacttgatatctctttatggaactacgggtgcaagggataggatttcgagtttggctttt
gatttagttaaaagagcaagaggtgtttgcgttaagcctttggctgtgggttttggtgtt
tcaaaggctgagcatgttagagagcttttgaaggctggtgccgatggggtagtcgttgga
agtgccatagtcaagctgatagaagagttcggtgaaaaagccggcgataaaattgaagag
aagtgtagagaactcagaaagggactttactattaa

DBGET integrated database retrieval system