KEGG   Archaeoglobus profundus: Arcpr_0205Help
Entry
Arcpr_0205        CDS       T01152                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
apo  Archaeoglobus profundus
Pathway
apo00260  Glycine, serine and threonine metabolism
apo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apo01100  Metabolic pathways
apo01110  Biosynthesis of secondary metabolites
apo01130  Biosynthesis of antibiotics
apo01230  Biosynthesis of amino acids
Module
apo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arcpr_0205
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Arcpr_0205
Enzymes [BR:apo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Arcpr_0205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Ribul_P_3_epim NanE
Motif
Other DBs
NCBI-ProteinID: ADB57276
JGI: Arcpr_0205
UniProt: D2RG51
Position
complement(173616..174371)
Genome map
AA seq 251 aa AA seqDB search
MIQKPSLITYITAGDPNVDATLEFLEILSKYSEIIELGIPFSDPMADGKTIEKSHYRALK
AGTKVKDVFRVIEEFKDNHRTPIVLMTYYNPVFVRGLDNFIGTAKDSGVDAMLVVDLPIE
EADDYLSVCEKYDMKTVFLASPNTPNDRLKAIDEASSGFVYLISLYGTTGARDRISSLAF
DLVKRARGVCVKPLAVGFGVSKAEHVRELLKAGADGVVVGSAIVKLIEEFGEKAGDKIEE
KCRELRKGLYY
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgattcaaaaaccctctctaataacgtatattacagcaggagacccgaacgttgatgca
actttagaattcctcgaaattctttccaaatacagtgagataattgagttgggaattccc
ttcagcgatccgatggctgacggtaaaacgattgaaaaatctcattacagggctttgaag
gctggaactaaggtgaaagatgtttttagggttattgaagagttcaaagacaaccatagg
actccgatagtcctcatgacatactacaatcccgtatttgtaagggggttggataatttt
attggaactgccaaagatagcggtgtggatgctatgctcgtcgttgatttgcctatagag
gaagctgacgattatttgagtgtttgcgaaaaatacgatatgaaaacagtctttttggct
tctccaaatactccaaacgataggcttaaggctatagatgaagcaagctctggcttcgtt
tacttgatatctctttatggaactacgggtgcaagggataggatttcgagtttggctttt
gatttagttaaaagagcaagaggtgtttgcgttaagcctttggctgtgggttttggtgtt
tcaaaggctgagcatgttagagagcttttgaaggctggtgccgatggggtagtcgttgga
agtgccatagtcaagctgatagaagagttcggtgaaaaagccggcgataaaattgaagag
aagtgtagagaactcagaaagggactttactattaa

DBGET integrated database retrieval system