KEGG   Archaeoglobus profundus: Arcpr_0206Help
Entry
Arcpr_0206        CDS       T01152                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
apo  Archaeoglobus profundus
Pathway
apo00260  Glycine, serine and threonine metabolism
apo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apo01100  Metabolic pathways
apo01110  Biosynthesis of secondary metabolites
apo01130  Biosynthesis of antibiotics
apo01230  Biosynthesis of amino acids
Module
apo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arcpr_0206
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Arcpr_0206
Enzymes [BR:apo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Arcpr_0206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF456
Motif
Other DBs
NCBI-ProteinID: ADB57277
JGI: Arcpr_0206
UniProt: D2RG52
Position
complement(174368..175531)
Genome map
AA seq 387 aa AA seqDB search
MKFGEFGGMFVAETLVQPLKELEKAYNELKDDETFKAELDYYLKNFAGRPTPLYYAKNLT
EKIGGAKIYLKREDLLHSGAHKINNTIGQALLAKYMGKSRLIAETGAGQHGVATAIAGAL
LGLKVDVYMGAEDVERQKMNVFRMKILGANVIPVESGTKTLKDAINEALRDWVATFEYTH
YLIGSVVGPHPYPTIVRDFQSVIGKETKKQILEIEGCLPDIIVACVGGGSNAMGIFHPFI
EDRKVRLVGVEAGGNGIETGKHSASLCAGKKGVLHGMLSYFLQDEDGQILDTHSVAPGLD
YPGVGPEHAYLKEIGRAEYVTVTDDEALKAFLELSRTEGILPALESAHALAYAMKIAEEM
SRDEIIVVNLSGRGDKDLDIVMREVGF
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttggtgagttcggggggatgttcgttgctgaaactcttgttcaacctttaaag
gagcttgaaaaagcttacaacgagcttaaagatgatgagacgtttaaggctgaactcgat
tactatttgaagaacttcgctggtcgcccaacaccactgtattacgctaaaaatctaacc
gagaagattggaggagctaagatttacctcaaacgtgaggatttacttcacagcggtgct
cataagataaacaacaccataggacaggctctacttgcgaaatacatgggaaaaagtcgt
ttaattgctgagactggggctgggcaacatggtgttgcgacggcaatagctggagctttg
ctcggtttaaaagtggatgtctacatgggtgctgaggatgttgagaggcagaagatgaac
gtctttaggatgaagattttaggtgcgaatgtcatacctgttgagagcgggactaagact
ttgaaagatgccataaacgaggctttaagggattgggttgcaacgttcgaatacactcac
tacctgataggctcagttgttggccctcatccctatccaacgatagtcagagatttccag
tcggtgattggtaaggagacgaagaagcagattttggagattgaaggttgcctgccagac
attatcgttgcgtgtgtaggtggtggtagtaacgctatgggaatattccatccgttcata
gaggacagaaaagtcaggcttgtgggtgttgaagctggcgggaatggtattgaaactggc
aaacactcggcttcactctgtgctggtaaaaagggagttctgcacgggatgctgagctac
ttcctgcaggatgaggacgggcagattttagatacccatagcgttgcacctggcttagac
tatcccggcgtaggtccggagcatgcgtatctgaaagagattggaagagctgaatacgta
acagttacggatgatgaggctttgaaagcatttctggagctttcgaggactgaaggtatc
ttaccagctttagaatccgctcacgctttagcttatgcaatgaagattgctgaggaaatg
agcagggatgaaataattgttgtaaacctttcgggaaggggagacaaggatttggacatt
gtcatgagggaggtgggattttga

DBGET integrated database retrieval system