KEGG   Archaeoglobus profundus: Arcpr_0252Help
Entry
Arcpr_0252        CDS       T01152                                 

Definition
(RefSeq) acetate/CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
apo  Archaeoglobus profundus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arcpr_0252
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcpr_0252
   00620 Pyruvate metabolism
    Arcpr_0252
   00640 Propanoate metabolism
    Arcpr_0252
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Arcpr_0252
   00680 Methane metabolism
    Arcpr_0252
Enzymes [BR:apo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Arcpr_0252
Lipid biosynthesis proteins [BR:apo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Arcpr_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(211610..213613)
Genome map
AA seq 667 aa AA seqDB search
MIKRRGLMKKDKSIESLLKVEEVYEPPKEFREKAWVKDESIYEKAEKDWIAFWDEIARTE
VEWFEPYKKVLDDSNAPFYKWFIGGKINITHNCLDRHVKTWRKNKAAIIWQGEPENDKRV
ITYYELYRRVCRFANALKNLGVRKGDRVTIYMGMVPELVVAMLACARIGAIHSVVFGGFS
SMALRDRINDAKAKVVITMDGFYRRGKIVETKKIVDEALEDAPSVEHVIVYDRLGLDVNM
VEDRDFWWDDVQYGSSWKCEPEVMDSEDPLFILYTSGTTGKPKGVLHVHGGYNVGTHITT
KWIFDIKDDDIYWCTADIGWITGHSYVVYGPLSNGATVLMYEGAPDYPKPDRWWSIIEYY
GVTVFYTAPTAIRYFMRLGEEWPKKHDLSSLRLLGTVGEPINPEAWKWYYRVIGGERCPI
VDTWWQTETGMIMITPLPGVTKLKPGSATKPFPGIKAEVWDDEGNPCPPNVGGKLVITRP
WPSMLRTLWGDPDRYIKTYWSAFEGKLVYFTGDGAKIDEDGYFWIMGRIDDVLNVSGHRL
GTMELESVLVAHKAVSEAAVIGKPHDIKGEVPVAFVVLKDGYEPSVELKRELREWVRKKI
GPIATPEEIIFVTKLPKTRSGKIMRRLLRAVLAGQPLGDVTTLEDEKALEEIKKSYEELK
RALEEQI
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaaaggaggggtttgatgaaaaaggataagtcgattgaatccctgttaaaggtt
gaagaggtttatgaaccaccaaaggagttcagagagaaggcttgggtaaaggatgagtca
atttacgagaaagctgagaaggactggatcgcattctgggatgagatagccagaacagag
gtggagtggtttgaaccgtacaagaaggttcttgatgatagcaacgcaccgttttacaag
tggttcataggaggaaagataaacatcactcacaactgccttgataggcacgttaaaact
tggaggaagaacaaggccgccataatatggcagggtgagccagagaatgataagagagtc
ataacatactacgagctctacagaagggtgtgcagatttgcaaacgctcttaagaacttg
ggtgttaggaagggagatagagtcacgatctacatgggtatggttccagagcttgtagtt
gcaatgttggcttgtgcaagaataggtgcaattcatagtgttgtgtttggaggattctca
tccatggctttaagagacaggataaatgatgctaaggctaaggttgtaataacaatggac
ggattttacagaagaggtaagattgtagagactaaaaagatagttgacgaggctttagaa
gatgctccaagtgttgagcacgttatagtttacgacagactcggattggatgttaacatg
gtggaggatagagatttctggtgggacgacgttcaatacggttcatcttggaagtgtgaa
ccagaggtgatggactccgaagatccactcttcatactatacacatctggaacgactggc
aagcctaagggagttttgcacgttcatggaggttacaacgtaggaacgcacataacaacg
aagtggatatttgacataaaggatgacgacatctactggtgtactgctgacataggctgg
ataacagggcatagctacgttgtttatgggccgttgagcaacggtgcgacagtactcatg
tacgaaggagctccggattatcccaagcccgacagatggtggagcataatagagtactac
ggagtaacggtattctacacagctccaacagcaataagatacttcatgcgacttggcgaa
gagtggccgaagaagcacgatctttcatcgctcagactcttgggaacagttggtgagcca
ataaatccggaggcttggaagtggtactacagagtcattggtggagaaagatgtccgata
gtagatacgtggtggcagaccgaaactggaatgataatgataaccccactaccgggtgta
acaaagctcaagcccggttctgctacaaaaccgttccccggtatcaaagctgaagtttgg
gatgacgaaggaaatccttgcccacccaacgtgggtggaaagttggtaataacgagacct
tggccttcaatgctgagaacgctttggggtgatccagacagatacatcaagacatactgg
agtgcgttcgaaggcaagttagtctacttcactggagatggtgctaaaattgatgaagat
ggatacttctggataatgggtagaatcgatgacgttctcaacgttagcggtcatagactt
ggaacgatggagcttgagagtgttcttgttgcccataaggccgttagcgaagctgcggtt
ataggaaagccacacgacataaagggtgaagtaccagtagctttcgttgtacttaaggac
ggttatgagcccagtgttgagctgaagagagaacttagggaatgggtaaggaaaaagata
ggaccaatagccactcctgaagagataatcttcgtaactaagctacctaagacgagaagc
ggtaagataatgagaagactccttagagcagtacttgcggggcagccgttgggagatgta
acaactttggaggatgagaaagctcttgaagaaataaagaagtcctacgaagagctaaag
agagctttagaggaacaaatctaa

DBGET integrated database retrieval system