KEGG   Archaeoglobus profundus: Arcpr_0252Help
Entry
Arcpr_0252        CDS       T01152                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
apo  Archaeoglobus profundus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arcpr_0252
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcpr_0252
   00620 Pyruvate metabolism
    Arcpr_0252
   00640 Propanoate metabolism
    Arcpr_0252
  Energy metabolism
   00680 Methane metabolism
    Arcpr_0252
Enzymes [BR:apo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Arcpr_0252
Lipid biosynthesis proteins [BR:apo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Arcpr_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(211610..213613)
Genome map
AA seq 667 aa AA seqDB search
MIKRRGLMKKDKSIESLLKVEEVYEPPKEFREKAWVKDESIYEKAEKDWIAFWDEIARTE
VEWFEPYKKVLDDSNAPFYKWFIGGKINITHNCLDRHVKTWRKNKAAIIWQGEPENDKRV
ITYYELYRRVCRFANALKNLGVRKGDRVTIYMGMVPELVVAMLACARIGAIHSVVFGGFS
SMALRDRINDAKAKVVITMDGFYRRGKIVETKKIVDEALEDAPSVEHVIVYDRLGLDVNM
VEDRDFWWDDVQYGSSWKCEPEVMDSEDPLFILYTSGTTGKPKGVLHVHGGYNVGTHITT
KWIFDIKDDDIYWCTADIGWITGHSYVVYGPLSNGATVLMYEGAPDYPKPDRWWSIIEYY
GVTVFYTAPTAIRYFMRLGEEWPKKHDLSSLRLLGTVGEPINPEAWKWYYRVIGGERCPI
VDTWWQTETGMIMITPLPGVTKLKPGSATKPFPGIKAEVWDDEGNPCPPNVGGKLVITRP
WPSMLRTLWGDPDRYIKTYWSAFEGKLVYFTGDGAKIDEDGYFWIMGRIDDVLNVSGHRL
GTMELESVLVAHKAVSEAAVIGKPHDIKGEVPVAFVVLKDGYEPSVELKRELREWVRKKI
GPIATPEEIIFVTKLPKTRSGKIMRRLLRAVLAGQPLGDVTTLEDEKALEEIKKSYEELK
RALEEQI
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaaaggaggggtttgatgaaaaaggataagtcgattgaatccctgttaaaggtt
gaagaggtttatgaaccaccaaaggagttcagagagaaggcttgggtaaaggatgagtca
atttacgagaaagctgagaaggactggatcgcattctgggatgagatagccagaacagag
gtggagtggtttgaaccgtacaagaaggttcttgatgatagcaacgcaccgttttacaag
tggttcataggaggaaagataaacatcactcacaactgccttgataggcacgttaaaact
tggaggaagaacaaggccgccataatatggcagggtgagccagagaatgataagagagtc
ataacatactacgagctctacagaagggtgtgcagatttgcaaacgctcttaagaacttg
ggtgttaggaagggagatagagtcacgatctacatgggtatggttccagagcttgtagtt
gcaatgttggcttgtgcaagaataggtgcaattcatagtgttgtgtttggaggattctca
tccatggctttaagagacaggataaatgatgctaaggctaaggttgtaataacaatggac
ggattttacagaagaggtaagattgtagagactaaaaagatagttgacgaggctttagaa
gatgctccaagtgttgagcacgttatagtttacgacagactcggattggatgttaacatg
gtggaggatagagatttctggtgggacgacgttcaatacggttcatcttggaagtgtgaa
ccagaggtgatggactccgaagatccactcttcatactatacacatctggaacgactggc
aagcctaagggagttttgcacgttcatggaggttacaacgtaggaacgcacataacaacg
aagtggatatttgacataaaggatgacgacatctactggtgtactgctgacataggctgg
ataacagggcatagctacgttgtttatgggccgttgagcaacggtgcgacagtactcatg
tacgaaggagctccggattatcccaagcccgacagatggtggagcataatagagtactac
ggagtaacggtattctacacagctccaacagcaataagatacttcatgcgacttggcgaa
gagtggccgaagaagcacgatctttcatcgctcagactcttgggaacagttggtgagcca
ataaatccggaggcttggaagtggtactacagagtcattggtggagaaagatgtccgata
gtagatacgtggtggcagaccgaaactggaatgataatgataaccccactaccgggtgta
acaaagctcaagcccggttctgctacaaaaccgttccccggtatcaaagctgaagtttgg
gatgacgaaggaaatccttgcccacccaacgtgggtggaaagttggtaataacgagacct
tggccttcaatgctgagaacgctttggggtgatccagacagatacatcaagacatactgg
agtgcgttcgaaggcaagttagtctacttcactggagatggtgctaaaattgatgaagat
ggatacttctggataatgggtagaatcgatgacgttctcaacgttagcggtcatagactt
ggaacgatggagcttgagagtgttcttgttgcccataaggccgttagcgaagctgcggtt
ataggaaagccacacgacataaagggtgaagtaccagtagctttcgttgtacttaaggac
ggttatgagcccagtgttgagctgaagagagaacttagggaatgggtaaggaaaaagata
ggaccaatagccactcctgaagagataatcttcgtaactaagctacctaagacgagaagc
ggtaagataatgagaagactccttagagcagtacttgcggggcagccgttgggagatgta
acaactttggaggatgagaaagctcttgaagaaataaagaagtcctacgaagagctaaag
agagctttagaggaacaaatctaa

DBGET integrated database retrieval system