KEGG   Archaeoglobus profundus: Arcpr_0267Help
Entry
Arcpr_0267        CDS       T01152                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apo  Archaeoglobus profundus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arcpr_0267
   01230 Biosynthesis of amino acids
    Arcpr_0267
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcpr_0267
   00051 Fructose and mannose metabolism
    Arcpr_0267
   00562 Inositol phosphate metabolism
    Arcpr_0267
Enzymes [BR:apo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Arcpr_0267
Exosome [BR:apo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Arcpr_0267
  Exosomal proteins of bladder cancer cells
   Arcpr_0267
  Exosomal proteins of melanoma cells
   Arcpr_0267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(226066..226725)
Genome map
AA seq 219 aa AA seqDB search
MGVIIINFKAYAEGSGKKAMEIARAVLEVSDKVDDYIAVAPNFLDLAEIARIGVDVYAQH
VDPIEFGSYTGRITAEMIKEKGAKGSLINHSERRLKLADIDFLIQKFKKVGLVSIVCTNN
VNTTKAVAVLDPDYVAVEPPELIGTGIPVSKAEPEVVENSVKAVKDLNPKVKVLCGAGIT
THEDYVRALDLGAEGVLLASGIVKAKDPKRALEELVGLR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgataataataaacttcaaagcctatgctgaaggctccggtaagaaggctatg
gagattgcgagagctgttttggaagtgagcgataaagttgatgattacattgctgtagca
ccaaacttcttggatttggctgagattgccagaattggtgttgatgtttacgctcagcac
gttgatcctatcgaatttggaagttacaccggaagaataactgctgaaatgataaaagag
aagggagcaaaagggagtttaatcaatcacagcgagagaagactaaagctggctgatata
gacttcctaattcagaagttcaagaaggtaggattggtttcgatagtttgcacgaataac
gtgaatacaactaaagccgttgctgttttagatccggattacgttgctgttgaacctcca
gagctgataggaacaggaattccggttagcaaggccgagccagaagttgtggaaaactcc
gttaaggccgtgaaagatctcaatcctaaggttaaggtgctatgtggtgctggaattact
acacatgaagactacgttagagctttggacttgggtgcagaaggcgttctgcttgcgagc
ggtattgtaaaggcgaaagacccaaagagagctttagaagagcttgtaggactgagataa

DBGET integrated database retrieval system