KEGG   Archaeoglobus profundus: Arcpr_0268Help
Entry
Arcpr_0268        CDS       T01152                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
apo  Archaeoglobus profundus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Arcpr_0268
Enzymes [BR:apo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Arcpr_0268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
226758..227657
Genome map
AA seq 299 aa AA seqDB search
MDAVGFGALNLDKVFLVSEIPKAEEESYVIDLQFSAGGSSANTIVGLAKLGLKTGFIGKV
GKDKEGEFLIRDLKSYGVDTGNVIVSEGRTGCAMVFVDRDGRRAILIDPAVNDTVGFDEI
DLEFVNQFKLLHLSSFVCKVSWKSFEAQKRLVEIFNGIVSFDPGSVYAKFGLEKIKPIIK
HTNIFMPNEIEVKLLTGLNYKEGAEFFLKWCDIVVVKRGEEGCYIASNEGCYEVPAHKVR
VVDTTGAGDAFNAGFLYGLLRGKNLEECAKLGNYLASLCIQHVGARTYLKHIDKRYLPL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtggatgctgttggcttcggagctttgaatctagataaggtcttcttggtcagcgagatc
ccaaaagctgaggaagaaagctacgttatcgatttgcagttttcagctgggggcagttct
gcaaatacaattgtcggtctagccaagctaggtctgaagacgggctttattggaaaagtt
gggaaggataaggaaggcgaatttttgattagggatcttaagagctacggggtagatacc
ggcaacgtgatagtttcggagggaagaacgggatgtgccatggttttcgttgatagggat
ggtaggagagccatactaattgatccagctgttaacgacactgtggggtttgatgagatc
gatttagaattcgtcaatcaatttaagctcttgcatttatcctccttcgtctgcaaggtt
agctggaaatcttttgaggctcagaagaggcttgttgaaatatttaatggaattgtgagc
ttcgatccgggcagtgtttacgcaaagtttggacttgagaagattaagcccataataaag
cacacaaacatcttcatgccaaacgagatcgaagtgaagcttttgactggcttaaattat
aaggaaggagcggaatttttcttgaagtggtgcgatattgttgttgttaagaggggtgag
gagggttgctacattgcgagcaatgaaggttgctacgaagtcccagctcacaaagtaagg
gtggtggatacgactggcgctggagatgcgttcaacgccggattcctctatggattacta
aggggtaaaaatttggaggagtgcgctaagctcggaaactacttagcgtcgctctgcatt
caacacgttggagcgagaacttatttgaagcatatagacaaacgttatctaccactctag

DBGET integrated database retrieval system