KEGG   Archaeoglobus profundus: Arcpr_0278Help
Entry
Arcpr_0278        CDS       T01152                                 

Definition
(GenBank) Phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
apo  Archaeoglobus profundus
Pathway
apo00010  Glycolysis / Gluconeogenesis
apo00030  Pentose phosphate pathway
apo00051  Fructose and mannose metabolism
apo00052  Galactose metabolism
apo00230  Purine metabolism
apo00500  Starch and sucrose metabolism
apo00520  Amino sugar and nucleotide sugar metabolism
apo00521  Streptomycin biosynthesis
apo01100  Metabolic pathways
apo01110  Biosynthesis of secondary metabolites
apo01120  Microbial metabolism in diverse environments
apo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcpr_0278
   00030 Pentose phosphate pathway
    Arcpr_0278
   00051 Fructose and mannose metabolism
    Arcpr_0278
   00052 Galactose metabolism
    Arcpr_0278
   00500 Starch and sucrose metabolism
    Arcpr_0278
   00520 Amino sugar and nucleotide sugar metabolism
    Arcpr_0278
  Nucleotide metabolism
   00230 Purine metabolism
    Arcpr_0278
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Arcpr_0278
Enzymes [BR:apo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Arcpr_0278
    5.4.2.8  phosphomannomutase
     Arcpr_0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADB57348
JGI: Arcpr_0278
UniProt: D2RGC3
Position
235847..237202
Genome map
AA seq 451 aa AA seqDB search
MTRIGAVGELFGTDGVRGVANEELTPEMAMNLGRVMGTLKRKVAVAMDTRISSYMLKSAV
IAGLTSCGCDVVDLGIAPTPALQYYVKSKDEIEGGIVVTASHNPREYGGIKFIQEDGREF
TRDMDAECERIYKSKSFRFASWDNIGQVYYDEYRRLYINGILSKVDVDAIAGKGFKVVID
CGNGAGYVTSPYILKELGCNVISINAHPDGRFPQRNPEPVEENVGLLKRVVKEVGADLGV
AHDGDADRATFVDEKGRFIPEDIMLALMAKYYVEKNNGGKVVTPVSSSKCVEDVVVEAGG
EVIYTPVGSPVVAETMLKVKAVFGGEGNGGLIFPEHLLARDGAMSFAKVLELMALENKPI
SELVKGIPKYYMIKTKLPCRDKIKLLKGLEEKFPDANFTDGARIDYEDSWILIRPSGTEP
IVRIFAEAKSKKKAKELVEFGIKVVKEILGE
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgacgagaataggtgccgtcggagagctttttggtactgacggtgttagaggagtagct
aacgaggaactaactcccgaaatggccatgaatttaggaagggttatgggaactctaaag
agaaaggttgctgtagctatggacacacgtatctcaagttacatgctcaagagtgcagtt
atagcaggtttgacgtcctgcgggtgtgatgtcgttgatctcggaatcgctccgactcca
gctttgcaatattacgttaagagcaaggatgagatcgagggaggaatagttgtcactgca
agccacaatccgagagagtatggaggtataaagttcattcaagaggatggcagggagttc
acaagagacatggatgcagagtgtgagcgtatttataagagcaaatccttcagatttgca
agctgggacaatattgggcaagtgtattacgatgaatatagaagattgtacataaacgga
attcttagcaaagttgacgtcgatgcgattgctgggaaggggtttaaggtcgttatagat
tgcggtaacggggctggctacgtaacttcgccttacatattgaaggagctaggttgtaat
gtgatcagcataaatgcgcatccggatggtcgatttcctcagagaaatcccgagcccgtt
gaagaaaatgttggattgttgaaaagggttgttaaagaggttggagcggatttgggtgtt
gctcatgacggagatgcggatagggcaacttttgttgatgagaaaggtagattcattcct
gaagacataatgctcgctttgatggctaaatattatgtggagaagaataacggtggtaaa
gttgtaaccccagtaagctcttcaaagtgtgttgaggatgtggttgtggaagctggtggt
gaagttatctacactccagtaggatcaccagtcgtcgctgaaaccatgcttaaagtaaag
gcagttttcggtggagaggggaatggcggtttaattttcccggagcacttgcttgcaagg
gatggagctatgagctttgcgaaggttttggagcttatggctttagaaaataaacctatc
tcagagttagtaaagggaattccgaagtactacatgataaagactaagttaccgtgcagg
gataagatcaagcttttgaaggggctggaagagaagtttccagatgcaaacttcacagat
ggggcaagaatagactacgaggacagctggattctcataagaccttcagggacggaacct
atagtcaggatatttgccgaggctaagtcaaagaagaaggctaaggagcttgtggagttt
ggaattaaggtcgtaaaggaaattttgggtgagtaa

DBGET integrated database retrieval system