KEGG   Archaeoglobus profundus: Arcpr_0479Help
Entry
Arcpr_0479        CDS       T01152                                 

Definition
RNA 3'-phosphate cyclase (EC:6.5.1.4)
Orthology
K01974  
RNA 3'-terminal phosphate cyclase (ATP) [EC:6.5.1.4]
Organism
apo  Archaeoglobus profundus
Brite
Enzymes [BR:apo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.4  RNA 3'-terminal-phosphate cyclase (ATP)
     Arcpr_0479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
407323..408321
Genome map
AA seq 332 aa AA seqDB search
MIKIDGSYGEGGGQILRTAIALSCVTQKPVEVYNIRANRPKPGLAMQHLKGIEAAKMITN
AEVEGLKLGSTRVVFKPRSLRGGNFKIDIGTAGSVTLILQTILLPSLYAERPSTFEIRGG
TDVKWSPSVDYVRFVTFKALEELGAKVELDLIARGYYPEGGGKIIVRVEPSKLRGKSFEV
LPCDVVKGISHCQNLPSHVAERQKNSAVSFLKERGYDAEVEIEVRKGISTGSGITLWCGY
KGSVELGEKGKRAEIVGKECAEKLVKELESDGAFDKHLADQIMPFSAVASGETVYTTTEV
TKHQISNAYVMNKFFDNVKIDGNRIEIDGIGL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagatagatggcagttacggtgaaggtggtggacagattttgagaactgctata
gcgctatcctgtgtgacgcaaaaacccgttgaggtttataatatcagagcaaacagaccc
aaacccggtttggctatgcaacacctaaaaggaattgaagctgcgaaaatgataactaac
gcagaggtagagggattgaagctaggatcaaccagagttgtttttaagccgagaagttta
aggggaggtaactttaaaattgatatcggaacagctggaagcgttactctcatacttcag
acaattcttctcccttcgctctacgcagaaagaccaagcacattcgagataaggggtgga
actgatgtaaagtggtcacccagcgttgactatgtaaggtttgtgactttcaaagctttg
gaggagttgggagctaaggttgagctcgatttaattgcaagggggtactatccagagggt
ggtgggaagataattgtaagggttgagccttcaaagctcaggggtaagagcttcgaagtt
ttaccttgcgatgtagttaaaggcataagtcactgtcagaatttaccaagtcatgtagct
gaaagacagaaaaattcagctgtgagctttctgaaggagagaggatacgatgcagaagtt
gaaattgaagtgagaaaggggatttcaacaggttcgggtataaccctttggtgcggttat
aagggcagtgttgagttaggtgagaaaggtaagagggctgagattgtcggaaaggagtgt
gccgaaaagcttgtaaaggagcttgaatctgatggagcctttgacaagcatttggccgat
cagataatgcctttctcagcagttgcaagtggcgaaactgtctacacgacaacagaagtc
acgaaacatcaaatcagcaacgcttacgtcatgaacaagtttttcgataatgtcaagata
gatgggaataggatagagatagatggaattggactgtaa

DBGET integrated database retrieval system