KEGG   Archaeoglobus profundus: Arcpr_0594Help
Entry
Arcpr_0594        CDS       T01152                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
apo  Archaeoglobus profundus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Arcpr_0594
Enzymes [BR:apo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Arcpr_0594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
508110..508655
Genome map
AA seq 181 aa AA seqDB search
MQKVINEMIKIGRKLGQFRLVDGASGNMSCRIGDFMLITRSGSILDDLTPQDFVYVKIGE
FCKGISSDWKVHKAIYEKTDYKAVLHCHGVYNVVLSLIHDEIVPRDLEGGIFLKKVRVVE
GEFGSDEVAEAIADEIARNGIAIHKGHGIYSAGKDMIEAFNKACYLEHSCEILYRLKVLK
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggtaattaacgaaatgataaagatcggaaggaagttgggtcagtttaggctt
gtagatggtgctagcgggaacatgagttgtagaattggagatttcatgctcattacaaga
agtgggtcaattttggatgatctaactcctcaagatttcgtttacgtcaagattggagaa
ttttgcaagggtatttcgagtgattggaaagttcacaaagcgatttacgagaaaacggat
tacaaagcagttttacactgtcacggcgtttacaacgtagttctttcacttattcatgat
gaaatcgttccaagagatttggagggaggtatttttctcaagaaggtgagggttgttgaa
ggagaatttggaagtgacgaagttgctgaggctatcgcagatgaaattgcaaggaatggt
atagctattcacaaggggcacggaatatattccgctggcaaagacatgattgaggctttt
aacaaagcctgctacttggagcactcatgcgaaattctgtataggctaaaggtgttgaag
cgttga

DBGET integrated database retrieval system