KEGG   Archaeoglobus profundus: Arcpr_0732Help
Entry
Arcpr_0732        CDS       T01152                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
apo  Archaeoglobus profundus
Pathway
apo00010  Glycolysis / Gluconeogenesis
apo01100  Metabolic pathways
apo01110  Biosynthesis of secondary metabolites
apo01120  Microbial metabolism in diverse environments
apo01130  Biosynthesis of antibiotics
apo01200  Carbon metabolism
apo01230  Biosynthesis of amino acids
Module
apo_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcpr_0732
Enzymes [BR:apo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Arcpr_0732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C Sacchrp_dh_NADP NAD_binding_3 Semialdhyde_dh TrkA_N F420_oxidored GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ADB57796
JGI: Arcpr_0732
UniProt: D2RHM1
Position
626417..627439
Genome map
AA seq 340 aa AA seqDB search
MKVKVAINGYGTIGKRVADAVSKQDDMEVIGVTKTKPDFEAKMAIRKGYKLYCAIPENLE
LFESAGIRVEGTVDDLINKADIVVDCSPGKVGAQNKPMYEKAGVKAIFQGGEKKDVAELS
FNALANYEKAVGKNYVRVVSCNTTGLVRVLYLLDTNFGIEKVRAVMIRRVVDPKEDKKGL
VNGIMPDPVKLPSHHGPDVQTVLPHIDITTVAFKVPTTLMHVHSLNVQLKEKASEDDVID
VFEKEPRILLVSKDDGFTSTAKIIEWARELRIRYDLFENVVWRDSIAVVGNELYLTQAIH
QEAIVVPENIDAIRAMLEMADKEESIRKTNESLDIGKFQI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcaaggttgcaataaacggttacggaacgattggtaagagggttgccgatgct
gtaagcaagcaggacgatatggaagttataggcgtcacaaagactaaacccgacttcgag
gctaagatggccataagaaagggatacaagctttactgtgcaattcctgaaaatttagag
ctttttgaatctgctggtattagggttgagggaacagttgatgatcttatcaataaggca
gatattgtagtcgattgctcacccggtaaagttggagctcaaaacaaaccaatgtatgag
aaggccggtgttaaggcgatatttcagggtggagagaagaaggatgttgctgaattatct
ttcaacgccttggcaaattatgaaaaggccgtgggcaagaactacgttagggttgtaagt
tgcaacactacgggattggttagagtcctttacctcctcgacacgaactttggaattgag
aaggtaagggctgtaatgattaggagggttgttgaccctaaggaagataagaagggtttg
gttaatgggataatgcccgatcccgtaaagttgccatcgcatcacggtccagacgtgcag
actgttttacctcacatcgacataacgactgtcgcattcaaagttccaacaacactcatg
cacgttcactcgctgaacgttcagctgaaggagaaagcgagtgaggatgatgtgatcgac
gttttcgagaaagagcctagaattctgctggtttcaaaggatgacggctttacatccaca
gccaagataatcgagtgggcgagagaacttagaattagatacgacctttttgaaaatgtc
gtttggagggattcgatcgcagttgttggtaacgagctttatcttactcaggcgattcat
caggaggctatagtagttccagagaacatagatgcgatcagagcgatgcttgagatggct
gataaggaggaaagcataaggaagacaaacgaaagcttagatattggcaagttccagatc
taa

DBGET integrated database retrieval system