KEGG   Archaeoglobus profundus: Arcpr_0741Help
Entry
Arcpr_0741        CDS       T01152                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
apo  Archaeoglobus profundus
Brite
Enzymes [BR:apo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Arcpr_0741
Transfer RNA biogenesis [BR:apo03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Arcpr_0741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(631779..633359)
Genome map
AA seq 526 aa AA seqDB search
MNALIEIGKEILRIKPKSKEEVAKIKKVVSRRFKLPKIPSDAEILKAWKGRAGYEELRDL
LRVKPVRTISGVAVVSVMSSPAPCPHGKCLMCPGGVERGTPQSYIGLEPAAQRGRQHHYH
PFRQVYARLNELHELGHDVDKVEIIVMGGTFPARPREYKEWFMLGIFNALNAFGKKRFKF
EKDLEKAKRKNERAKARCIGITFETRPDYAGEEHIIEMLRFGGTKVEIGVQSVYDDVLET
IRRGHTVEDIVRATQLLKDSAFKVGYHVMPGLPNSNFERDLKMFRIIFEDERFKPDYLKI
YPTLVVEGTELYKWYKKGLYKPYSTEEVVELIALAKRRFPVWVRVQRIQRDIPVDKAIGL
DKGNIRQLVHAKLKELGYSCRCIRCREVGHKLRGKDVEELLKDAELVIRRYRASKGIEYF
ISYEIPSYDALIGFIRLRFPHKPFIKAIEDCALIRELHVYGRAVPIGVKEKGAFQHRGFG
EKLLKTAEEIAKEKFDEIAVISGVGVREYYRKFGYRKRFEYMVKKL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcactaatagagatagggaaggagatactgaggattaagcctaagagcaaggag
gaagttgcgaagataaagaaagtagtcagccgaaggttcaagctacctaaaattcctagc
gatgccgaaattctcaaggcttggaagggtagagcgggttacgaggagttgagagatcta
ttgagggttaaaccagtaagaacgatttccggtgtggctgttgtgagtgtgatgtcttct
ccagctccatgtcctcatggaaagtgcttgatgtgtcccggtggagttgagagaggtacg
ccacaaagctatattggtttggagcctgcggcacagagagggagacagcatcactatcat
ccgttcaggcaggtttatgcaaggttgaacgagctccacgagttggggcacgatgtcgac
aaggttgagataatcgtgatgggtggaacatttccagcgagacctagagaatacaaggaa
tggttcatgctcggaatctttaacgccttgaacgcttttggaaagaagagatttaagttc
gagaaagatttagagaaggctaagagaaagaatgagagggctaaagccagatgtatcggt
ataacgttcgaaacacgcccagattatgccggagaggaacatataatcgagatgttgaga
tttggcggaactaaagttgaaattggtgtgcaaagcgtttacgatgatgtgcttgagaca
ataaggagaggacacacggttgaggacatagttagggctactcaactcttgaaggattcc
gccttcaaagttggttatcacgtaatgcccggtttaccaaattcaaattttgaaagggac
ctaaagatgttcaggatcatatttgaagatgagagattcaagccagattaccttaagatt
tacccaacgctggttgttgagggaacggagctttacaagtggtataagaagggcttatac
aagccttacagcacggaggaggttgtagagcttatagctttagctaaaaggcgtttccca
gtttgggtgagagttcagagaattcagagagacattccagtcgataaagctatcggattg
gataagggaaacataaggcagttagttcatgccaagcttaaggagttgggttacagctgt
agatgcataagatgtagggaagttggacacaagctgagaggtaaggatgttgaagaattg
ttgaaagatgcagagcttgtgattagaagatatagggcatcaaaggggattgaatacttt
atatcctatgagattccaagctacgatgctctcattggattcatcaggctgagattcccg
cataagcctttcataaaggctatagaggactgtgcactaataagggagttgcacgtttac
ggtagggctgttccgataggtgtaaaggagaaaggagcattccagcatcgaggttttggt
gagaaacttcttaagactgctgaagagattgcaaaagaaaagtttgatgagattgcagtt
ataagtggtgttggagttagagaatactacaggaagttcggatacagaaaaaggtttgag
tatatggttaaaaagctgtga

DBGET integrated database retrieval system