KEGG   Archaeoglobus profundus: Arcpr_1040Help
Entry
Arcpr_1040        CDS       T01152                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K14466  
4-hydroxybutyrate---CoA ligase (AMP-forming) [EC:6.2.1.40]
Organism
apo  Archaeoglobus profundus
Pathway
Carbon fixation pathways in prokaryotes
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arcpr_1040
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Arcpr_1040
Enzymes [BR:apo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.40  4-hydroxybutyrate---CoA ligase
     Arcpr_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(875872..877608)
Genome map
AA seq 578 aa AA seqDB search
MKRLFEEFIEISELDDIDKERKLKDFFSRLNGKKIEEFNWADEVFEGIHVKNNGDKTALH
WVDLDTGEEKKFTYSGFAKISNGIVRFLRENGIEKGEFFHFMLPLIPEVWFSHYVAVKGG
FIGVPHANILRERDLEYRFKVAKPSAIIADESSAEVVDEALKMAKVEPKVKIIVGDREGW
EPFDSIEPKNCEGAKTKADDPIFCFFTSGTTGLPKGVIHTATSYPVGHLSTAYIINVKPD
DIHNNLSAAGWGKFAWSSFFSPFIVGATVLGLHFTRFKPEKYLEAIDSYGVNTFCAPPTA
WRMFMLVDVKSKGLKFENLREVVSAGEPLNPEIFNWWKDLTGIEIRDFYGQTESTAMIGN
PPWFKGRIVPGSFGVPTYMYDIVLLDDDLNEITQPKVVGHIAVRLSRWRPIGLFKGYFGN
AREDAFVGDYYLTGDKAYFDERGYWWFVARADDIIKTSDYRVGPFEVESVLLEHPAVAEA
AVVGSPDPIRWQIVKAFVVLKPEYKPSRELALELFKHCKNILAKFKIPRIIEFVDSLPKT
ISGKIKRKELRIMEEERKKRGERGEHEYFYSEFPELKG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagactcttcgaagaattcatagagatatcagaactcgacgatatagacaaagag
agaaagcttaaagatttttttagtagattgaacggaaagaagatcgaggaatttaactgg
gctgatgaggtttttgaaggaattcatgtcaaaaataatggcgataaaacggctttgcat
tgggttgatctcgatactggagaagaaaagaaatttacatacagcggattcgcaaagatt
tcgaatggtattgtgcgtttcttgagggaaaacggcatcgaaaagggcgagttcttccac
ttcatgctcccgctcattccagaggtctggttcagccactacgttgcagtcaaaggtgga
tttattggagttcctcatgcgaacatccttagggaaagagacttggaataccgatttaag
gttgcaaaaccctctgcaataattgccgatgaaagttcggctgaagttgttgacgaagct
ttaaagatggctaaggtcgagccgaaggtcaaaataatcgttggcgatagggaaggatgg
gaaccttttgattcgatagagcctaaaaactgtgaaggtgcaaagactaaagcagatgat
ccaattttctgtttcttcacatccggcactaccggattgccaaaaggggttatacacact
gcaacatcctatccagtcgggcatctttcaactgcttacataataaacgttaagccggat
gatattcacaacaacttgagcgccgcagggtggggaaagtttgcttggagttctttcttc
tctccgtttatagttggtgcaactgtcttaggtttgcattttactaggttcaaaccagaa
aaatacttagaagctattgatagctatggcgtaaacacattctgtgcgcctcctacagca
tggcgaatgtttatgctcgtcgatgttaagagtaaaggattgaagttcgaaaacttgaga
gaagttgttagtgcgggagaacctttgaaccccgagattttcaactggtggaaggattta
acagggatagagataagggacttctacgggcaaactgaaagcacggcaatgataggtaat
ccgccttggtttaaaggaaggattgttccgggctcattcggagttccgacatacatgtac
gatatagttctgcttgacgatgacctcaacgaaattactcaacccaaagttgtgggtcat
atagctgtaaggttgagtagatggagacctatagggctgtttaagggctacttcggaaat
gcgagagaagatgctttcgtaggtgattactacctcacgggtgacaaggcatatttcgat
gagaggggctactggtggttcgttgctagagcagatgacatcattaagacttcggattat
agagtcgggccttttgaggttgagagcgttttgcttgagcatccagccgtagctgaagct
gcagttgtaggaagtcctgatcccataaggtggcagatcgttaaagcctttgtagtgcta
aagccggaatacaaaccgtctagggaacttgccttagagcttttcaagcactgtaagaac
atactggcgaaattcaagattccgaggataattgaatttgtagattccctaccgaaaacg
attagtggcaaaataaagaggaaggagcttagaataatggaagaggagagaaagaagaga
ggtgaaaggggtgagcatgaatatttctatagtgaatttcctgaattgaaggggtga

DBGET integrated database retrieval system