KEGG   Archaeoglobus profundus: Arcpr_1057Help
Entry
Arcpr_1057        CDS       T01152                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
apo  Archaeoglobus profundus
Pathway
apo00010  Glycolysis / Gluconeogenesis
apo00020  Citrate cycle (TCA cycle)
apo00620  Pyruvate metabolism
apo00633  Nitrotoluene degradation
apo00640  Propanoate metabolism
apo00650  Butanoate metabolism
apo00680  Methane metabolism
apo00720  Carbon fixation pathways in prokaryotes
apo01100  Metabolic pathways
apo01120  Microbial metabolism in diverse environments
apo01130  Biosynthesis of antibiotics
apo01200  Carbon metabolism
Module
apo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcpr_1057
   00020 Citrate cycle (TCA cycle)
    Arcpr_1057
   00620 Pyruvate metabolism
    Arcpr_1057
   00640 Propanoate metabolism
    Arcpr_1057
   00650 Butanoate metabolism
    Arcpr_1057
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Arcpr_1057
   00680 Methane metabolism
    Arcpr_1057
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Arcpr_1057
Enzymes [BR:apo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Arcpr_1057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ADB58116
JGI: Arcpr_1057
UniProt: D2RDC2
Position
896081..896647
Genome map
AA seq 188 aa AA seqDB search
MRFHGRGGQGVVTAADILAVAAFKEGYWTLSFPMFGAEKRGGPVVSYLKISESKINDRDE
IYEPDYAVVLDPTILSKDVVNGLKGWLIANYPDLEKAKEKTKWERTITIDATKLALEILG
RPITNTAMVGAFAGFTKIVKLSTLKETIYEWFEKKNEEIAKKNVEVAERAYREVEKYADK
LRSSIKTA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtgagatttcatggtaggggtggacaaggcgttgtgactgcagcagatatactcgccgtt
gcggcatttaaagagggttattggacactttcatttccaatgttcggagcggagaagaga
ggaggtccagtcgtatcctacttgaagatctcggagagcaagataaacgacagagatgaa
atctatgaaccagactacgcagtggtcctcgatccgaccatactcagtaaggatgttgtt
aacggtttgaagggctggcttatagccaactatccagacttggagaaggcaaaggagaag
acgaaatgggagcgaacgattacgatagatgctacaaagctcgcactcgaaatactcggt
agaccaataacaaacactgccatggttggtgcgtttgcaggctttacgaagatagtgaaa
ttgagcactcttaaagagaccatatacgagtggtttgagaaaaagaatgaagaaatagcc
aaaaagaatgttgaagtagctgaaagggcttatagggaggttgagaagtatgcggataag
cttaggagcagtatcaagaccgcttga

DBGET integrated database retrieval system