KEGG   Archaeoglobus profundus: Arcpr_1058Help
Entry
Arcpr_1058        CDS       T01152                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
apo  Archaeoglobus profundus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arcpr_1058
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcpr_1058
   00020 Citrate cycle (TCA cycle)
    Arcpr_1058
   00620 Pyruvate metabolism
    Arcpr_1058
   00640 Propanoate metabolism
    Arcpr_1058
   00650 Butanoate metabolism
    Arcpr_1058
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Arcpr_1058
   00680 Methane metabolism
    Arcpr_1058
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Arcpr_1058
Enzymes [BR:apo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Arcpr_1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
896610..896885
Genome map
AA seq 91 aa AA seqDB search
MRISLGAVSRPLESLENKTGSWAVKIPKVNPDKCVGCGECRMLCPDGCIELVHVEEKKVV
AKVDYDYCKGCGICSDICPANAIEMVEKVIE
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgcggataagcttaggagcagtatcaagaccgcttgaatctttggaaaacaagacgggt
agctgggctgttaaaattccgaaggtaaatccagataaatgcgtagggtgtggggagtgt
cgaatgctgtgcccagatggatgtatagaactcgtgcatgttgaagagaagaaagtagta
gctaaagtcgattatgattactgtaagggctgcggtatatgtagtgatatatgccccgca
aacgctatagaaatggttgagaaggtgatcgaatga

DBGET integrated database retrieval system