KEGG   Archaeoglobus profundus: Arcpr_1059Help
Entry
Arcpr_1059        CDS       T01152                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
apo  Archaeoglobus profundus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arcpr_1059
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcpr_1059
   00020 Citrate cycle (TCA cycle)
    Arcpr_1059
   00620 Pyruvate metabolism
    Arcpr_1059
   00640 Propanoate metabolism
    Arcpr_1059
   00650 Butanoate metabolism
    Arcpr_1059
  Energy metabolism
   00680 Methane metabolism
    Arcpr_1059
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Arcpr_1059
Enzymes [BR:apo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Arcpr_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
896882..898024
Genome map
AA seq 380 aa AA seqDB search
MRKVVRGFYAVAHAVKLCRPNIICAYPITPQTEIVENLAEMYANGELENCKYITAESEFD
AASILVGASATGARTFTATCSQGLILMSEVLFNAAGMRLPIVMVNTNRAISAPLSIWNDL
QDSMVLRDAGIIQIYVEDNQEAHEMIPQAYKIAESVMFPTMVCMDGFKLTHAYEPIDLLD
QELVDSFLPPYDPPIKLSVDNPLTFGSYAPPHCYMEFRYRMHKDMVNAKKTIEKVFKEWA
EIRRDWGGLIEYKEGKTVLVAMGSLIGTIKEVAEENGLGYLKIRTYRPFPTEEIKEALKD
CENVIVFDRAVSFGYEGILTIDIRNALYGESPDVYSFIVGLGGRDVPKKLIEKCVSKVVN
KEIKPSYSFEGLKEFEEVLY
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaggtagttagaggattctacgccgttgcacatgctgtaaagctctgtagaccg
aatataatatgcgcttatccaataacacctcaaacggagatagtagagaatttggcagag
atgtatgcaaacggagaactcgagaactgtaaatatataactgctgaatccgaattcgat
gctgcatcaatcttggttggcgcctctgcaactggtgcgaggactttcactgcgacatgc
tcacagggtttgatattgatgagtgaagttctgtttaacgcagccgggatgaggctacca
atagtaatggttaacacgaacagagctatatctgcaccgcttagcatatggaacgatctc
caagacagcatggtgttgagagatgccggtataattcagatatacgttgaggataatcag
gaagctcacgagatgattccccaagcttacaagattgctgaaagcgtaatgtttccaacg
atggtttgtatggatggtttcaagctaactcacgcttatgagccaatagatttgctcgat
caggagttggtagatagcttccttccaccctacgatcctccgataaagctctcagtagat
aatcctctaacgtttggctcctacgctccaccgcactgctacatggagttcagatacaga
atgcacaaagacatggtcaacgctaaaaagacaatcgagaaagtcttcaaagaatgggct
gaaataaggagagactggggaggattgatagagtacaaggaggggaagactgttcttgtc
gcaatgggttccttgataggaactataaaagaggtagctgaggagaacggattgggttat
ctcaagataagaacttacagaccattcccaaccgaagaaataaaagaggctttgaaagat
tgtgaaaacgtcatagtgtttgatagagcagtttcgttcggatatgaaggaattttaacc
atagatatcagaaacgcactctacggcgaatcaccagatgtctactccttcatagtaggt
ttaggtggtagagatgttccaaagaaactcatagaaaagtgtgtttcgaaggtagttaac
aaagagattaagcccagttacagttttgaaggtttaaaggagtttgaggaggtgctatac
tga

DBGET integrated database retrieval system