KEGG   Archaeoglobus profundus: Arcpr_1060Help
Entry
Arcpr_1060        CDS       T01152                                 

Definition
thiamine pyrophosphate domain-containing TPP-binding protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
apo  Archaeoglobus profundus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arcpr_1060
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcpr_1060
   00020 Citrate cycle (TCA cycle)
    Arcpr_1060
   00620 Pyruvate metabolism
    Arcpr_1060
   00640 Propanoate metabolism
    Arcpr_1060
   00650 Butanoate metabolism
    Arcpr_1060
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Arcpr_1060
   00680 Methane metabolism
    Arcpr_1060
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Arcpr_1060
Enzymes [BR:apo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Arcpr_1060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
898024..898896
Genome map
AA seq 290 aa AA seqDB search
MFFGKGHGGCYGCPLPIVVRNVLEVLEGKCFVVNPTGCLEIISSQYGKSAWGVPYIHSLF
ENGPSVASGIANALEVLGRENEGHVVVFAGDGATADIGIGYLSSMLHRNDNVLYICLDNE
AYQNTGTQQSSTTTPGAYTTTTPAGKILPGKISRRKDMVAFALAHGTPYVATASVAFPRD
LRRKVKRAVEFRGAKYIHVHCPCPTGWHFDPSKTVYVARLAYETALFPIVEFEFGKLVRV
KKIKSRKPVEEYLKVQGRFRHLFKHPEGPKIIAKLQQIADENAVRYGLDV
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgttctttgggaagggtcatggtggttgctacggatgcccactgccgatagtcgttaga
aatgtcttggaagttttggagggtaagtgctttgtagttaatccgactggctgtctcgag
ataataagttcacagtacggtaaaagcgcttggggtgtgccttacatacactcactcttt
gaaaacggtccttcagttgcctccggtattgcaaacgcgttagaagtattgggaagggaa
aatgagggacacgtcgtcgtatttgctggagatggagccacagcagatataggaatagga
tatttatcatctatgcttcacagaaacgacaacgtcctctacatctgtctggataacgaa
gcttatcagaacacgggaacacaacagagctctaccaccacaccgggtgcatatacaaca
acaactccagctggaaaaattttacccggaaaaatttcgagaagaaaggatatggttgca
tttgccttagctcacggaactccatacgttgctacagcctccgtagcttttccaagagat
ctgagaagaaaggttaagagggctgtggaatttaggggtgcaaagtacattcacgttcac
tgcccctgcccaaccggatggcacttcgatccatctaaaactgtctatgttgcaaggctc
gcatacgaaacagccttgttcccaatagttgaatttgaattcggaaaactcgttagagtc
aagaagataaagagcagaaagccggtcgaagagtacttgaaagttcaggggagattcaga
catctattcaagcatccagagggaccaaaaataatcgcgaagctccaacagattgcggat
gagaatgcagttagatacggactggatgtttga

DBGET integrated database retrieval system