KEGG   Archaeoglobus profundus: Arcpr_1070Help
Entry
Arcpr_1070        CDS       T01152                                 

Definition
magnesium chelatase ChlI subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
apo  Archaeoglobus profundus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Arcpr_1070
Enzymes [BR:apo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Arcpr_1070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
910672..912579
Genome map
AA seq 635 aa AA seqDB search
MEAREKRLIFPFSAIVGQENAKLALLCVAVNPLIGGVLLKGDKGTGKSTMVRALANVLPD
IEVVADCPFNCNPSNPLEMCDSCYKRYENGEDLPVARRKMRVVDLPLSVTIDRLVGTVDV
ERFLKEGVKALQPGILAEANRNILYIDEVNLLDDYIADSLLDSAAMGWNVIEREGISFKH
PARFILVGSMNPEEGELRPQILDRFGLCVEVSAPMNPEDRIEIVRRVEKFHEDPIGFYRK
FENKEKELTEKIVKAKEILPKVEISEDLLKLLAETVIKLGIKTNRAEIATIKTAKAIAAL
NGRRRVTLDDLEKAMELALPHRLKDKPFQKPQPLKLKQDENDRKEKNKNQNEQGHEHKHS
HKHEDKGSGNRGQGGEQNFRSSEVDIPRMENASLKDDLNSYLSSRDSSVTVINFPKGVPV
SYVPPKDEIRDVDFYSSIVWAVMSGKTPPIRVDSSDIRVRVRKSKAPTLWVLVLDSSGSM
AIQKRISVAKGIAEKLVEKGYVKKSKMALIVAKGNRAEIVVPPTKNYLKVIESIENVPTG
GRTPLSSALYNLLLLAKRERMKEKTLKVRAFLITDGKANVPLLGKRIKDEIIELASRLKK
CDIELNVYDTRFAGEIGLSFIPILKDVANARVYKV
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggaggctcgcgaaaagcgcttgatctttccattttcggcaatagtggggcaggagaac
gctaagttagctctgctttgtgtggcagtcaacccgttaataggcggagtattacttaag
ggcgataaaggaactggaaaatcaacgatggttagagctttagcgaacgttttgccagac
atcgaagttgtagcggattgtccattcaactgcaacccctcaaaccctttagagatgtgc
gacagctgttataagagatacgagaacggcgaggatttgccagtggcaagaaggaaaatg
agggttgtagacttacccttaagtgtaacaatagataggttggttggaactgtggatgtt
gaaaggtttctgaaggagggagttaaggcgttacagcccggaatactcgctgaggctaac
agaaacatcctatacatcgacgaggtgaacctgctcgatgactacatagcggattcgctt
ttagattcagccgcgatgggatggaacgttatagagagggagggtatttcgtttaagcat
ccagcccgctttattttagttggatcgatgaatccggaggaaggtgaactaagaccgcaa
attttagacagatttggactgtgcgttgaggtaagtgctccaatgaatcccgaagataga
atagagatcgttaggagagttgagaagtttcatgaggatcctataggattctacaggaag
ttcgagaacaaggagaaggagctaactgaaaagattgtcaaggcgaaggagatactgcca
aaagtcgagataagcgaagatcttctaaagctcttagccgagactgtcataaaattgggt
ataaaaacaaacagggctgagatagctacgataaaaactgccaaagccatagccgcgcta
aatggaaggagaagggttacacttgatgacttggagaaagcaatggagttggcattacca
cacagacttaaggacaaaccctttcaaaagcctcaacccctaaagctgaagcaggacgaa
aatgatagaaaagagaagaacaaaaatcagaatgaacaaggacacgagcacaagcatagc
cataaacatgaagacaagggcagtggaaatagaggacaaggaggtgagcaaaactttcgt
tcgagcgaagtagatatcccaagaatggaaaatgctagcttgaaggatgatctcaatagc
tatctatcatcgagggattcgagcgttacggtgataaacttcccgaagggagttccagtt
tcctacgtaccacctaaggatgagattagagatgtagacttttacagctctatagtttgg
gctgttatgagtggtaagacacctcccataagagtagattcgagcgacattcgtgtgaga
gttaggaagtcgaaggctccgactctttgggttcttgtgttggactcgagtggtagtatg
gctattcagaagaggataagcgttgcaaaggggattgctgaaaagctcgttgagaaagga
tacgttaagaaatctaagatggctttaatagttgctaagggtaatcgtgctgagatcgtc
gttcctccaactaagaattacttgaaagttatcgaaagtatcgagaacgttccaactggt
ggtagaactcctttaagttcggccctctacaacctgttattgctggctaaaagggagaga
atgaaggaaaagacgttgaaggttagggcctttcttataacagatggaaaggcaaacgtt
ccgttacttggcaagagaattaaagatgaaataatcgagcttgcaagtaggcttaaaaag
tgtgatatagaattgaacgtttacgatacgaggtttgcaggagaaataggtctttcattc
attccaattttgaaagacgtggcgaatgcaagggtttacaaggtttaa

DBGET integrated database retrieval system