KEGG   Archaeoglobus profundus: Arcpr_1101Help
Entry
Arcpr_1101        CDS       T01152                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
apo  Archaeoglobus profundus
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Arcpr_1101
Enzymes [BR:apo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Arcpr_1101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
934802..935638
Genome map
AA seq 278 aa AA seqDB search
MHIDSFFSLSNSDLDSAEFVVAGIPYDRSQSFLPGSRFAPNAIRIASWNLESYSSIFDVD
LDLLRICDAGNINVDGDFNVVLKNVENFVSKVKDKVLISLGGEHTVSYAVVRALGNDFCY
LVIDAHLDLRESFDNDPYNHACTCRRISELGIDIIYLGARSYTKEELEFARYKNFKIFKP
FNFKIDELEDVLSSYDKVYLSIDVDGFDPSFAPGVSTPEPFGLNPTITLEIFRRFSEKIV
AMDLVEVVPDDNYVTPMLCARIIFEFLASKSLSSTEKL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcacatagattctttcttctcactatcgaattcggatcttgattcagctgagttcgta
gtagctggcataccctacgacagatcccagtccttcttacccggttcgaggtttgctccc
aacgctataagaattgcaagctggaatttagaaagttactcttcgatattcgatgtcgat
ttagatttactgagaatttgcgatgctggaaatatcaatgtcgatggagactttaacgtc
gttctgaaaaatgttgagaattttgtctcaaaagttaaagataaagttttgatttcattg
ggtggagaacatacggtcagttacgccgttgttagggcgttgggtaacgacttctgttat
ctcgtcatagacgcacatctcgatctgagagaatctttcgataacgatccatacaaccac
gcatgcacgtgcagaagaatctccgagctcggaatagatataatttatttgggagctaga
agctataccaaagaggagctagaatttgctagatataaaaatttcaagatatttaagcca
ttcaattttaagattgatgaacttgaagatgttttaagctcctacgacaaggtatactta
tcaatagatgttgacggatttgatccctcatttgctccgggagtatctactcctgaacct
ttcggcttaaatccgacaataacgcttgaaatattcagaaggttttctgaaaagatagta
gctatggatcttgtcgaagttgtgccagatgataactacgtgacgcccatgctctgtgct
agaataatctttgaattcctagcttcgaaaagtttatcatctacggaaaaactttga

  All links  
No link information was found.   
DBGET integrated database retrieval system