KEGG   Archaeoglobus profundus: Arcpr_1123Help
Entry
Arcpr_1123        CDS       T01152                                 

Definition
(RefSeq) AMP phosphorylase
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
apo  Archaeoglobus profundus
Brite
Enzymes [BR:apo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Arcpr_1123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(955339..956859)
Genome map
AA seq 506 aa AA seqDB search
MKLIAKIIPIKSVRPLAIMNQSDAEELGVFEGDRVRLVAGRKYLTATVQIALGFIEKGYI
GICLKSAEDLGVEDGSEVDVIPIPKPASFEYIRKKLDGHKLTREEIYEIVRDIVNDALTE
VELTAFVLSSYVHGMDLDEVEWMTRAMIETGETIDFEEGIVVDKHSIGGVPGNKISLIIV
PTVASAGLLIPKTASRAITSASGTADTMEVLANVNLSIEEIKEITLRVGGVIAWGGATNI
APADDKIIRVEYPLAIDPRSQLLASVMAKKGAIGAEHVVIDVPVGEGSKVPDVEEGKKLA
NDFVELGRRLGLNVTCAITYGGQPVGRAVGPALEAWEALKAMEERKGAKSLMEKALGIAG
IIFEMVGKTTNGYEYAKEIFESGKTLEKFKQIVEAQGGDPNVRSDDIPIGDKTYDVISPI
DGAVAKVYNSRIVKVARAAGAPKDKGAGVLLFKKGGFHVKKGDVLFRIYAEKEWKLDKAI
EVALKEPPVVVSGMILERYPSYRWMR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcatagctaaaataataccaataaaaagcgttagacccctcgccataatgaat
cagagtgatgctgaagagttgggagtatttgaaggtgatagagttaggctggtagctggg
aggaagtacttaacggctacggtccaaatagctttgggctttatcgagaagggctacatt
ggtatctgtctgaaatcggcagaggatttaggtgttgaggatggtagcgaggtcgatgta
ataccgataccaaagcccgcatcttttgagtatataagaaagaagctcgacggtcataag
cttacgagagaggagatatacgagatagttagggacatagtaaatgatgctcttactgaa
gtagagctaacagctttcgttctatctagctatgtgcatggaatggatctagatgaagtc
gagtggatgacgagggcaatgatagagacaggggaaactattgatttcgaggaggggata
gtcgtagataagcacagcataggaggtgtgcccggtaacaagatttccttgataatagta
ccgactgtagcttcagctggtcttctaatacctaaaacagcaagcagagctataacatct
gcaagtggaactgctgataccatggaagtactagcaaacgttaacctgagcatagaggag
ataaaggagataacacttagagttggtggagtaattgcatggggcggtgcaacgaacata
gctcccgctgacgataagataataagggttgagtatcctttagccatagatccaagatca
cagcttttagcaagtgttatggcaaagaaaggggctataggagctgaacatgttgtaata
gatgtgccggttggtgagggctccaaggttccagatgttgaagaggggaagaagctcgcc
aacgattttgtggagctgggaaggcgtttgggcttgaatgttacctgtgctataacctat
ggtggtcaaccggtcggtagggctgtaggcccggctttagaggcttgggaagctttaaag
gctatggaggaaaggaaaggagcaaagagcttgatggagaaggctttgggaatagctgga
ataatatttgagatggttggaaaaactacaaatggatacgagtatgcgaaggagatattc
gaatctgggaaaactctggaaaagtttaagcagatcgttgaggcacaaggcggagatccc
aatgtgaggtctgacgatatccccatcggagataaaacgtacgatgttattagccccata
gatggggcagttgcaaaggtgtacaacagtagaatagttaaagttgcgagagctgctgga
gcaccgaaagataagggtgcgggagtactgctctttaagaaaggaggatttcacgttaag
aagggtgatgttcttttcagaatatatgcagagaaggagtggaagcttgacaaggctata
gaagtggctctcaaagagccacctgtggtagtttcgggcatgatactcgaaaggtatcca
tcctacaggtggatgaggtga

DBGET integrated database retrieval system