KEGG   Archaeoglobus profundus: Arcpr_1202Help
Entry
Arcpr_1202        CDS       T01152                                 

Definition
dTDP-4-dehydrorhamnose 3 5-epimerase-like protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
apo  Archaeoglobus profundus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Arcpr_1202
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Arcpr_1202
Enzymes [BR:apo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Arcpr_1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1019797..1020294
Genome map
AA seq 165 aa AA seqDB search
MLPGIVIKPLKRFADERGFFTEIMRKDWEIFEDEIVQANLSITYPGIVRAWHKHERGQVD
YFVCIKGAIKICAYDDKTQELAEIISTGDNPQIVRIPGHYWHGFKALGVEPAMLVYFVNR
LYDYKNPDEVRRPWNDPTIVPKRINGREDDPRCNKPWDWFYPPHK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccggtatagttatcaagccattgaagaggtttgcggatgagaggggatttttc
acagagataatgcgcaaggactgggagatattcgaagatgagatagttcaggcaaatcta
tcgattacatatccaggaattgtcagggcttggcacaagcacgaaagggggcaggtagat
tacttcgtctgcataaaaggtgctatcaagatctgtgcttacgacgataaaactcaggaa
ttggccgaaataatatctactggggataatccgcagatagttaggattcctggacactac
tggcacggttttaaagctttgggagtcgaaccggctatgctcgtttacttcgtcaacaga
ctctacgattacaagaatcctgacgaggtaagaaggccttggaacgatcccacgatagtt
cctaagaggatcaacggcagagaggacgatccccgctgcaacaaaccttgggactggttt
tatcctccgcacaaatga

DBGET integrated database retrieval system