KEGG   Archaeoglobus profundus: Arcpr_1215Help
Entry
Arcpr_1215        CDS       T01152                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
apo  Archaeoglobus profundus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Arcpr_1215
   00052 Galactose metabolism
    Arcpr_1215
   00500 Starch and sucrose metabolism
    Arcpr_1215
   00520 Amino sugar and nucleotide sugar metabolism
    Arcpr_1215
Enzymes [BR:apo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Arcpr_1215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1033705..1034547)
Genome map
AA seq 280 aa AA seqDB search
MKVRKAVIPAAGYGTRMLPITKAQPKEMVPVVHKPVIQYVVEEAYYSGIREILIITGKHK
RAIEDHFDRSDLPKKDKYTEELDKILDEVDIFFVRQREQKGLGDAVRYAEAFVDDEPFAL
LLGDNITIPPCTKMLIDIFEKYGSPVIAVERVPRKRIPLHGIIKGFEVGEGIYKIEDMVE
KPRIEEAPSDLAVLGRYILTPEIFDYLKNLKPGYGGEIQLTDALRDMAREKDVYGVLYKG
KRYDIGNKLAWLKANVELAFNDEELGAELKNFVKKLVAQE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcagaaaagcggttattcccgcagcaggctatggaacgagaatgttacccatt
actaaagctcagcctaaggaaatggttccagttgttcataaaccagttattcagtatgtt
gttgaggaagcatattactcgggtataagggagattttaattataactggtaagcacaag
agagcgatagaagatcacttcgatagaagcgatctacctaagaaagacaaatacacggaa
gagctggacaaaatcttggatgaagtggacatattcttcgtaaggcagagagagcaaaaa
ggattgggtgatgcagtcaggtatgctgaagctttcgttgatgacgagcctttcgctttg
ttattgggagataacattacgattccaccgtgtacaaaaatgttgatagatatctttgaa
aagtatggatcgccagtgatcgctgttgagagagttccaaggaagaggatcccgctccat
ggaattataaagggtttcgaggttggagagggaatttacaagatagaagatatggttgag
aaacctagaattgaagaagccccatcagatcttgccgttctcggaagatacatcctgact
cctgaaattttcgactacctgaagaatctaaagcccggatatggtggagagattcagctc
acagacgctttgagagatatggctagagaaaaggacgtctacggtgtactttacaaggga
aagaggtacgatatcgggaataagctcgcatggcttaaggcgaatgttgagttagctttt
aatgatgaagagcttggagcagagctcaaaaattttgtgaagaagcttgtagctcaagaa
tag

DBGET integrated database retrieval system