KEGG   Archaeoglobus profundus: Arcpr_1315Help
Entry
Arcpr_1315        CDS       T01152                                 

Definition
(GenBank) PfkB domain protein
Organism
apo  Archaeoglobus profundus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1129730..1130617)
Genome map
AA seq 295 aa AA seqDB search
MFAGVGPALIDYIHTIDQYPPRGGHAVVKSTVKSAGGAGANVIYGLSRYGVKCSFYSTIG
KDEDAELFKDSMKGVYLKLSVTHEKTGKVNVYVDRDGERTFFVHPNASGVLKLEMDDEDF
KMNDYFYLDPFPSEKSLDVHTDIAKRAKEFGKTVILSMSYPYVIMGFEKLKGILKYIDIA
ITSKAEFDLLGVDEEDILKFVDIFVITMGKEGAKAIAQDGVYYYPAYDVKVVDTTGAGDA
FAVGFFYCYIKGYDLNTCLKIGNLVASYNIQRYGARNFPPLHEVEDHIGHNCKDV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcaggagtaggcccagctttaatagattacattcacacaatagaccagtatccg
ccaagaggggggcatgctgtcgtcaaaagtacagttaaatcagctggaggggctggagcg
aacgtaatttatggattatcaagatacggtgtcaaatgctcattttactccactattgga
aaggatgaggatgctgaactgtttaaagacagtatgaaaggagtttatctcaagttgtca
gttacccatgagaaaacgggaaaggttaacgtttacgttgatagagatggagagagaaca
ttctttgttcatccgaacgcttctggagtcttaaagcttgaaatggatgatgaagacttt
aagatgaatgactatttctatctagatccctttccatctgaaaaaagtctcgatgtacac
acggatattgctaaaagggctaaggaattcggaaaaactgtaattcttagcatgagctat
ccctatgtgatcatgggttttgagaagctgaaaggaattctcaaatacatcgatatagct
ataacatccaaagcggagtttgatcttctaggtgtagatgaagaagatattctcaagttt
gtcgatatcttcgtgattacaatggggaaagaaggagcgaaggcaatagcgcaagatgga
gtttactattatcccgcttacgatgtcaaggttgtagatacgactggtgcgggtgatgcc
tttgcagttggctttttctactgctatattaagggctacgatttgaacacatgcttaaag
attgggaacctcgttgcaagctacaacatccagcgttatggtgcaagaaactttccaccg
ttacatgaggttgaagaccatataggtcataattgtaaagatgtatga

DBGET integrated database retrieval system