KEGG   Archaeoglobus profundus: Arcpr_1433Help
Entry
Arcpr_1433        CDS       T01152                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
apo  Archaeoglobus profundus
Pathway
apo00860  Porphyrin and chlorophyll metabolism
apo01100  Metabolic pathways
apo01110  Biosynthesis of secondary metabolites
apo01120  Microbial metabolism in diverse environments
Module
apo_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Arcpr_1433
Enzymes [BR:apo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Arcpr_1433
Exosome [BR:apo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Arcpr_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Amidase02_C DUF1265
Motif
Other DBs
NCBI-ProteinID: ADB58481
JGI: Arcpr_1433
UniProt: D2RED7
Position
1223961..1224887
Genome map
AA seq 308 aa AA seqDB search
MREAKVELDDLIVPIFVDETISKPLEIRSMPGYYRIPVEGVVEEVEKCLDLGLNSFIFFG
IPSYKDEIGSSAFDKNGVIQKAVRLVRKEFPDVVIVTDVCLCEYTTHGHCGIVKDGKIMN
DETLPILGKIAVSHAEAGADIVAPSGMMDGMVKAIRSALDDEGFTDVAIMSYSAKYASSF
YGPFREAADSGYKFGDRRSYQADIHNGDEALREVELDLKEGADIVMVKPALAYLDIVRRV
KETFRVPTCAYNVSGEYSMVKASAIQGWLDEKDIVYEILTSIKRAGADLIITYHAKDFAR
WMKEGFDW
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagagaggctaaagttgaattagacgatctcatcgtcccgatatttgttgacgaaacc
atctcaaaacctttggaaattcgttcgatgcccggatactacagaatcccagttgagggg
gtagttgaagaagttgaaaagtgtttagatttgggtttaaattcgttcatattctttgga
attccgtcgtacaaagacgaaataggttcttcagcctttgacaaaaatggtgtcattcaa
aaagctgtcagacttgtgagaaaggagtttcctgatgttgtcatagtaacagacgtctgc
ctatgcgaatacactacacacgggcactgcgggatagttaaagacgggaagattatgaac
gatgaaacactgccaatactcggaaagatagcagtaagtcatgctgaagccggtgccgat
attgttgctccatctggcatgatggatggaatggttaaagccataaggagcgccttggat
gatgaaggctttaccgatgttgcgataatgagctactcagccaaatacgcatcgagcttc
tacgggccattcagagaggctgcggatagcggctacaagttcggagatagaaggagttat
caggcggatatacacaacggtgatgaagctttaagagaagtagaacttgatttgaaagag
ggagcagatatagtaatggtcaaacccgctctggcgtacttggacatagttaggagagtt
aaggagacatttagagttccaacgtgtgcatacaacgtaagtggagaatattcgatggtt
aaggcctcagctattcaaggctggcttgatgagaaggatatagtttacgagattttaacg
agcataaagagggccggagcagatttgataatcacataccatgcgaaagatttcgctagg
tggatgaaggaaggattcgattggtaa

DBGET integrated database retrieval system