KEGG   Archaeoglobus profundus: Arcpr_1433Help
Entry
Arcpr_1433        CDS       T01152                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
apo  Archaeoglobus profundus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Arcpr_1433
Enzymes [BR:apo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Arcpr_1433
Exosome [BR:apo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Arcpr_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1223961..1224887
Genome map
AA seq 308 aa AA seqDB search
MREAKVELDDLIVPIFVDETISKPLEIRSMPGYYRIPVEGVVEEVEKCLDLGLNSFIFFG
IPSYKDEIGSSAFDKNGVIQKAVRLVRKEFPDVVIVTDVCLCEYTTHGHCGIVKDGKIMN
DETLPILGKIAVSHAEAGADIVAPSGMMDGMVKAIRSALDDEGFTDVAIMSYSAKYASSF
YGPFREAADSGYKFGDRRSYQADIHNGDEALREVELDLKEGADIVMVKPALAYLDIVRRV
KETFRVPTCAYNVSGEYSMVKASAIQGWLDEKDIVYEILTSIKRAGADLIITYHAKDFAR
WMKEGFDW
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgagagaggctaaagttgaattagacgatctcatcgtcccgatatttgttgacgaaacc
atctcaaaacctttggaaattcgttcgatgcccggatactacagaatcccagttgagggg
gtagttgaagaagttgaaaagtgtttagatttgggtttaaattcgttcatattctttgga
attccgtcgtacaaagacgaaataggttcttcagcctttgacaaaaatggtgtcattcaa
aaagctgtcagacttgtgagaaaggagtttcctgatgttgtcatagtaacagacgtctgc
ctatgcgaatacactacacacgggcactgcgggatagttaaagacgggaagattatgaac
gatgaaacactgccaatactcggaaagatagcagtaagtcatgctgaagccggtgccgat
attgttgctccatctggcatgatggatggaatggttaaagccataaggagcgccttggat
gatgaaggctttaccgatgttgcgataatgagctactcagccaaatacgcatcgagcttc
tacgggccattcagagaggctgcggatagcggctacaagttcggagatagaaggagttat
caggcggatatacacaacggtgatgaagctttaagagaagtagaacttgatttgaaagag
ggagcagatatagtaatggtcaaacccgctctggcgtacttggacatagttaggagagtt
aaggagacatttagagttccaacgtgtgcatacaacgtaagtggagaatattcgatggtt
aaggcctcagctattcaaggctggcttgatgagaaggatatagtttacgagattttaacg
agcataaagagggccggagcagatttgataatcacataccatgcgaaagatttcgctagg
tggatgaaggaaggattcgattggtaa

DBGET integrated database retrieval system