KEGG   Archaeoglobus profundus: Arcpr_1558Help
Entry
Arcpr_1558        CDS       T01152                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
apo  Archaeoglobus profundus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arcpr_1558
  Amino acid metabolism
   00300 Lysine biosynthesis
    Arcpr_1558
Enzymes [BR:apo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Arcpr_1558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1319234..1320439
Genome map
AA seq 401 aa AA seqDB search
MKEEVSRECEKYREEMIEVACKLIELKAISPDYGGEGELDKAEYIESLLEGFEVERFDAK
DDRAKGGVRPNIVAKVCDGERMLWIVSHMDVVPEGDLALWETPPFKAVVKDGKIYGRGAE
DNNQAIVSSLFAGKVVKNLMKKGFEPKIGFGLVFVSDEETGSEYGIKYLLKQGIFNKDDL
IVVPDAGNERGDEIEIAEKSVLWLKFRVHGIQSHASTPKLNANRRAMEFLLELDKTLHSK
FSATNKLFNPPYSTFEPTKREKNVDNVNTVPGLDVSYMDCRVLPEYDLNDVLRVVNEVKA
KFVERDKKPIEVEVLQTNSSPPTPEDSDVVEILRKAIKLMRVIDARPIGIGGNTCASFFR
QFGIHTAVWATFVGNAHEPNEFCLIDNMVEDAKVFALLPFI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggaggtaagtagggagtgtgagaaatatagagaggaaatgatagaggtagca
tgcaagcttattgaactaaaagcaataagcccagactacggtggggagggagagctggac
aaagctgagtacattgaaagtcttctcgaagggtttgaagttgagagattcgatgcgaaa
gatgacagagctaagggtggtgttagaccgaacatagttgctaaggtctgcgatggggaa
agaatgctttggatagtttcacacatggatgtcgtgcccgaaggagatctggctttgtgg
gaaacaccaccctttaaagcggttgttaaggatggtaagatttacgggagaggggccgaa
gacaataaccaagcaatagtttcttccctattcgctggcaaggttgttaaaaatctgatg
aaaaagggttttgagcctaagatcggttttggtttagttttcgtgtccgatgaggagacc
ggtagcgaatacggaataaagtatcttttgaagcaaggtatcttcaacaaagacgacttg
atagttgttccagatgctggaaacgaaagaggagatgaaatagaaatagcggaaaagagc
gtactttggttaaagtttagggttcatggaatccagagtcatgcaagtacaccgaagctg
aatgcgaatagaagggctatggaattcctacttgagctagacaaaactttgcacagcaag
tttagcgcaacaaacaaactcttcaatccaccatactcaacatttgagcctactaagaga
gagaaaaacgttgacaacgttaacactgttccaggattggatgtcagctacatggattgt
agagttctgccggaatacgatctaaacgatgttttaagggttgtcaatgaagttaaagcc
aagttcgttgaaagggacaagaagcccatagaggttgaagttttgcaaactaactcctca
ccaccaacgccagaggacagcgatgtggttgaaatccttaggaaggctataaagttgatg
agggtaatcgatgctaggcccattggaataggcggaaacacttgtgcctccttcttcagg
cagttcggaattcatacagcagtctgggcaacttttgtgggcaatgcgcacgaaccaaac
gagttttgtctaatagacaacatggtggaggatgccaaagtatttgcactcctacccttt
atctaa

DBGET integrated database retrieval system