KEGG   Archaeoglobus profundus: Arcpr_1592Help
Entry
Arcpr_1592        CDS       T01152                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
apo  Archaeoglobus profundus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arcpr_1592
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arcpr_1592
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Arcpr_1592
Enzymes [BR:apo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Arcpr_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1354305..1355486)
Genome map
AA seq 393 aa AA seqDB search
MSYSLVCIECGKEHGEESYTCDCGGLLEVRFKDVEVDFKLDGNPWGVWKYRCLLPVKIDP
VTLKEGGTPLYRCDSLSKELNCRVYVKHEGANPSGSFKDRGMTVGVTKALELGKKAVACA
STGNTSASMAMYAAKAGLKAYVLLPAGKVALGKVAQALMHGAKVIAIKGNFDRALELVRQ
VCKEMNFYLLNSVNPFRLEGQKTIAFEIVDELGFVPDYVVLPVGNAGNISAIYKGFKELK
QLSLIDSTPKMIGVQAKGANPIYKAVMEGKDVIEPVTNPETVATAIRIGNPVNARKALRA
IYESKGTAVEVNDEEIIQAQKDLARKEGIGVEPASASSLAGLRKLVENGYIGSDETVVCI
TTGHLLKDPEIVLKVCGQPIEVPAEFEEIIKVL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagctactctttggtgtgtatagagtgtgggaaagagcatggggaagaatcctacaca
tgcgactgcggtgggcttttggaagtgaggtttaaagacgttgaggtcgattttaagctt
gacggtaatccttggggagtttggaaatatcgttgtcttttaccagttaaaattgatcca
gttacactgaaggaaggtggaactccactttacaggtgtgacagcttgagtaaggagttg
aattgcagggtttacgtgaagcacgaaggagcaaacccttcaggctcattcaaagacagg
ggaatgaccgtaggcgttaccaaagctttggaattaggtaaaaaggcagttgcatgtgca
tcgactggcaacacctccgcatctatggctatgtatgcagccaaagctggattgaaggct
tacgtacttttgccagctggcaaagttgccttaggcaaagtagcccaagctttgatgcac
ggagctaaggttatagccatcaagggcaacttcgatagggctttagagttagttagacag
gtttgtaaggagatgaacttttaccttctcaactcggtcaatccgttcagattagaggga
caaaagactatagccttcgaaatagtcgatgagcttggatttgtgccagattacgttgtc
ttacctgtgggaaatgccgggaacatctccgctatttacaagggtttcaaagaactcaaa
caactcagcttaatagactccactccgaagatgattggtgttcaagctaaaggtgctaat
ccgatatacaaggctgtaatggaaggaaaagacgttatagagcccgtcacaaatccagaa
acggttgcaaccgctataaggataggaaatccagtaaatgcaagaaaggctttgagagca
atttacgaatcaaagggaacggcagtagaggtcaatgacgaggagataatacaggctcaa
aaggatttagccagaaaagaaggaataggtgttgagcctgcatcagcatcaagcttagct
ggattgaggaagttagttgaaaacggttatattggaagtgatgagactgtcgtctgtata
acaactggtcatctactcaaagatcccgaaatcgtgttaaaggtgtgtggtcagccgata
gaagtgccagcagagtttgaagagattataaaagtcttatag

DBGET integrated database retrieval system