KEGG   Archaeoglobus profundus: Arcpr_1592Help
Entry
Arcpr_1592        CDS       T01152                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
apo  Archaeoglobus profundus
Pathway
apo00260  Glycine, serine and threonine metabolism
apo00750  Vitamin B6 metabolism
apo01100  Metabolic pathways
apo01110  Biosynthesis of secondary metabolites
apo01120  Microbial metabolism in diverse environments
apo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arcpr_1592
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Arcpr_1592
Enzymes [BR:apo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Arcpr_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADB58638
JGI: Arcpr_1592
UniProt: D2REU4
Position
complement(1354305..1355486)
Genome map
AA seq 393 aa AA seqDB search
MSYSLVCIECGKEHGEESYTCDCGGLLEVRFKDVEVDFKLDGNPWGVWKYRCLLPVKIDP
VTLKEGGTPLYRCDSLSKELNCRVYVKHEGANPSGSFKDRGMTVGVTKALELGKKAVACA
STGNTSASMAMYAAKAGLKAYVLLPAGKVALGKVAQALMHGAKVIAIKGNFDRALELVRQ
VCKEMNFYLLNSVNPFRLEGQKTIAFEIVDELGFVPDYVVLPVGNAGNISAIYKGFKELK
QLSLIDSTPKMIGVQAKGANPIYKAVMEGKDVIEPVTNPETVATAIRIGNPVNARKALRA
IYESKGTAVEVNDEEIIQAQKDLARKEGIGVEPASASSLAGLRKLVENGYIGSDETVVCI
TTGHLLKDPEIVLKVCGQPIEVPAEFEEIIKVL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagctactctttggtgtgtatagagtgtgggaaagagcatggggaagaatcctacaca
tgcgactgcggtgggcttttggaagtgaggtttaaagacgttgaggtcgattttaagctt
gacggtaatccttggggagtttggaaatatcgttgtcttttaccagttaaaattgatcca
gttacactgaaggaaggtggaactccactttacaggtgtgacagcttgagtaaggagttg
aattgcagggtttacgtgaagcacgaaggagcaaacccttcaggctcattcaaagacagg
ggaatgaccgtaggcgttaccaaagctttggaattaggtaaaaaggcagttgcatgtgca
tcgactggcaacacctccgcatctatggctatgtatgcagccaaagctggattgaaggct
tacgtacttttgccagctggcaaagttgccttaggcaaagtagcccaagctttgatgcac
ggagctaaggttatagccatcaagggcaacttcgatagggctttagagttagttagacag
gtttgtaaggagatgaacttttaccttctcaactcggtcaatccgttcagattagaggga
caaaagactatagccttcgaaatagtcgatgagcttggatttgtgccagattacgttgtc
ttacctgtgggaaatgccgggaacatctccgctatttacaagggtttcaaagaactcaaa
caactcagcttaatagactccactccgaagatgattggtgttcaagctaaaggtgctaat
ccgatatacaaggctgtaatggaaggaaaagacgttatagagcccgtcacaaatccagaa
acggttgcaaccgctataaggataggaaatccagtaaatgcaagaaaggctttgagagca
atttacgaatcaaagggaacggcagtagaggtcaatgacgaggagataatacaggctcaa
aaggatttagccagaaaagaaggaataggtgttgagcctgcatcagcatcaagcttagct
ggattgaggaagttagttgaaaacggttatattggaagtgatgagactgtcgtctgtata
acaactggtcatctactcaaagatcccgaaatcgtgttaaaggtgtgtggtcagccgata
gaagtgccagcagagtttgaagagattataaaagtcttatag

DBGET integrated database retrieval system