KEGG   Accumulibacter phosphatis: CAP2UW1_0237Help
Entry
CAP2UW1_0237      CDS       T00966                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
app  Accumulibacter phosphatis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAP2UW1_0237
   01230 Biosynthesis of amino acids
    CAP2UW1_0237
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAP2UW1_0237
   00030 Pentose phosphate pathway
    CAP2UW1_0237
   00051 Fructose and mannose metabolism
    CAP2UW1_0237
   00052 Galactose metabolism
    CAP2UW1_0237
  Energy metabolism
   00680 Methane metabolism
    CAP2UW1_0237
Enzymes [BR:app01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CAP2UW1_0237
Protein phosphatases and associated proteins [BR:app01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CAP2UW1_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(289225..291462)
Genome map
AA seq 745 aa AA seqDB search
MNMNNKSPPKSIGVLTSGGDAQGMNAAVRAVVRTALHQGAAVYAIYEGYQGMVDGGERIR
LQSWDDVGSILHRGGTIIGTARCAAFRERAGRLRAAHNLLRHGIDRLVIIGGDGSLTGAD
TFRREWPGLLAELLESGQIDEQTARAHPALMIAGLVGSIDNDMVGTDMTIGADSALHRIV
EAIDAIASTAASHQRSFVVEVMGRHCGYLALMSAIAGGTDYVLIPESPPPEGWEEQMCGL
LRQGRIAGRRDSIVVVAEGAQDRAGNPISCDYVRQVLQERLDEDTRVTILGHVQRGGTPS
SFDRWMSTLLGFAAVQEVLSATPDSEPQLIGIRQNRIQRVPLMQCVEQTRAVAQMIGEQN
YARAMELRGGSFTEMFDVFKAIAEASPSVTATTRPRRLAIIHAGGLAPGMNSAVRAAVRF
GRDRGLTLLGVRGSFEGLLAGRIEELTWGDVEGWTGLGGCELGTNRHIPSVEELYAVARA
IETHQIEGLLVIGGWMAYKAAYQLHCERDRYPAFKIPIICLPATIDNNLPGSELSVGADS
ALNAIVGALDRVKQSAMAAKRCFVVETMGRYCGYLALMSGLAGGAERVYLHEEGVTLKDL
QAEVEHMVDAFHTGRRLYLTIRNERANAQYTTDFMCALFEEEGRGLFDVRRSVLGHFQQG
GNPSPYDRILATRLAAHCISFLSEQLASGSADGAFIGLVEGKVTLVPLGRMSEMVDWTHF
RPKEQWWLELRPVVQTMAQSIATEA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgaacaacaagagtcccccaaagagtatcggcgtcctcaccagcggcggcgac
gcccagggcatgaacgcggccgtgcgggccgtcgtccgcaccgcgctgcatcagggcgcc
gccgtttacgccatctacgaaggctatcagggaatggtagatggtggcgaacgcatccgg
ctacagtcctgggatgatgtcggcagcatcctgcatcgcggcggcacaatcatcggcacc
gctcgctgcgccgccttccgcgaacgcgcagggcggctgcgcgccgcccacaacctgctt
cgccacggcattgaccgactggtcatcatcggcggtgacggcagtctgaccggcgccgac
acttttcgccgagagtggcccggcctgctggccgaattgctggagagcggacagattgac
gaacagacggcgcgcgcgcacccagcgctgatgatcgccggcctggtcggatcgatcgac
aacgacatggtcgggaccgacatgacgatcggtgccgattccgccctgcaccgcatcgtc
gaggcgatcgacgccattgccagcaccgccgccagtcatcaacgcagtttcgtggttgag
gtcatgggtcgccactgcggctatctggctttgatgagcgccattgccggcggcaccgac
tacgtactcattcccgaaagcccgccacccgagggctgggaagaacagatgtgcggcttg
ttgcgccagggccgcattgccggccgccgcgacagcatcgtcgtcgtcgccgagggcgcc
caggaccgcgctggcaacccgatcagttgtgactatgtgcggcaggtgctccaggagcga
ctcgacgaggacacccgcgtgaccattctcggtcatgtgcagcgcggcggcacgcccagc
agcttcgatcgctggatgagcactttgctcggctttgccgctgttcaggaggtgctttcg
gcgacgcccgacagtgaaccgcaactgatcgggatccgccaaaaccgtattcagcgggta
cccttgatgcagtgcgtcgagcagactcgcgccgttgcccaaatgatcggcgagcagaac
tacgcccgggcaatggagcttcgtggcggcagctttaccgagatgttcgacgttttcaag
gcaatcgccgaggcctcaccgagcgtgactgcgacgacccgcccgcgccgcctggcgatc
attcatgcgggaggactggcgccggggatgaattctgccgtgcgtgccgcggtacgcttc
ggtcgggatcggggcctgaccctgctcggcgtgcgcggcagtttcgagggcctgctcgcc
ggccgaatcgaggaactcacctggggcgacgttgaaggctggaccggcctgggcggctgt
gaactgggcaccaatcgccacatccccagcgtcgaggagctctacgccgtcgcgcgcgcg
attgaaacgcaccagatcgaaggcctgctggtcatcggcggctggatggcctacaaggca
gcgtaccagttgcactgcgagcgcgaccgctatcccgccttcaagatcccgatcatctgc
ctgccggcgacgatcgacaacaacctgcccggctcggaactcagcgttggcgccgatagc
gcgctcaacgccattgtcggcgccctcgatcgggtcaagcagtcggcgatggccgccaag
cgctgttttgtggtcgaaaccatgggccgctactgtggctacctggcactgatgagtggt
ctggccggtggcgccgaacgcgtctatctgcacgaggaaggcgtcaccctgaaggacctg
caagccgaagtcgagcatatggtggacgcgttccacactggccgacgactctacctgacc
atacgcaacgagcgagccaacgcgcagtacacgaccgacttcatgtgtgcgctgttcgag
gaggagggtcgcggtctctttgacgtgcgccgttccgtgctgggccatttccagcagggc
ggcaatccctcgccgtacgatcgcattctggcaacgcgactggcggcgcactgcatcagc
ttcctgagtgagcaactggcaagcggctcggcggatggcgccttcattggtctggtcgag
ggcaaggtcacgctcgttccgctcggcaggatgtcggagatggtcgattggacccatttt
cggcccaaggaacagtggtggctggagctgcgaccggtggttcaaacgatggcgcagtcg
atcgcgacggaggcctga

DBGET integrated database retrieval system