KEGG   Accumulibacter phosphatis: CAP2UW1_0237Help
Entry
CAP2UW1_0237      CDS       T00966                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
app  Accumulibacter phosphatis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:app01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:app01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:app00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:app00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:app00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:app00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:app00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(289225..291462)
Genome map
AA seq 745 aa AA seqDB search
MNMNNKSPPKSIGVLTSGGDAQGMNAAVRAVVRTALHQGAAVYAIYEGYQGMVDGGERIR
LQSWDDVGSILHRGGTIIGTARCAAFRERAGRLRAAHNLLRHGIDRLVIIGGDGSLTGAD
TFRREWPGLLAELLESGQIDEQTARAHPALMIAGLVGSIDNDMVGTDMTIGADSALHRIV
EAIDAIASTAASHQRSFVVEVMGRHCGYLALMSAIAGGTDYVLIPESPPPEGWEEQMCGL
LRQGRIAGRRDSIVVVAEGAQDRAGNPISCDYVRQVLQERLDEDTRVTILGHVQRGGTPS
SFDRWMSTLLGFAAVQEVLSATPDSEPQLIGIRQNRIQRVPLMQCVEQTRAVAQMIGEQN
YARAMELRGGSFTEMFDVFKAIAEASPSVTATTRPRRLAIIHAGGLAPGMNSAVRAAVRF
GRDRGLTLLGVRGSFEGLLAGRIEELTWGDVEGWTGLGGCELGTNRHIPSVEELYAVARA
IETHQIEGLLVIGGWMAYKAAYQLHCERDRYPAFKIPIICLPATIDNNLPGSELSVGADS
ALNAIVGALDRVKQSAMAAKRCFVVETMGRYCGYLALMSGLAGGAERVYLHEEGVTLKDL
QAEVEHMVDAFHTGRRLYLTIRNERANAQYTTDFMCALFEEEGRGLFDVRRSVLGHFQQG
GNPSPYDRILATRLAAHCISFLSEQLASGSADGAFIGLVEGKVTLVPLGRMSEMVDWTHF
RPKEQWWLELRPVVQTMAQSIATEA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgaacaacaagagtcccccaaagagtatcggcgtcctcaccagcggcggcgac
gcccagggcatgaacgcggccgtgcgggccgtcgtccgcaccgcgctgcatcagggcgcc
gccgtttacgccatctacgaaggctatcagggaatggtagatggtggcgaacgcatccgg
ctacagtcctgggatgatgtcggcagcatcctgcatcgcggcggcacaatcatcggcacc
gctcgctgcgccgccttccgcgaacgcgcagggcggctgcgcgccgcccacaacctgctt
cgccacggcattgaccgactggtcatcatcggcggtgacggcagtctgaccggcgccgac
acttttcgccgagagtggcccggcctgctggccgaattgctggagagcggacagattgac
gaacagacggcgcgcgcgcacccagcgctgatgatcgccggcctggtcggatcgatcgac
aacgacatggtcgggaccgacatgacgatcggtgccgattccgccctgcaccgcatcgtc
gaggcgatcgacgccattgccagcaccgccgccagtcatcaacgcagtttcgtggttgag
gtcatgggtcgccactgcggctatctggctttgatgagcgccattgccggcggcaccgac
tacgtactcattcccgaaagcccgccacccgagggctgggaagaacagatgtgcggcttg
ttgcgccagggccgcattgccggccgccgcgacagcatcgtcgtcgtcgccgagggcgcc
caggaccgcgctggcaacccgatcagttgtgactatgtgcggcaggtgctccaggagcga
ctcgacgaggacacccgcgtgaccattctcggtcatgtgcagcgcggcggcacgcccagc
agcttcgatcgctggatgagcactttgctcggctttgccgctgttcaggaggtgctttcg
gcgacgcccgacagtgaaccgcaactgatcgggatccgccaaaaccgtattcagcgggta
cccttgatgcagtgcgtcgagcagactcgcgccgttgcccaaatgatcggcgagcagaac
tacgcccgggcaatggagcttcgtggcggcagctttaccgagatgttcgacgttttcaag
gcaatcgccgaggcctcaccgagcgtgactgcgacgacccgcccgcgccgcctggcgatc
attcatgcgggaggactggcgccggggatgaattctgccgtgcgtgccgcggtacgcttc
ggtcgggatcggggcctgaccctgctcggcgtgcgcggcagtttcgagggcctgctcgcc
ggccgaatcgaggaactcacctggggcgacgttgaaggctggaccggcctgggcggctgt
gaactgggcaccaatcgccacatccccagcgtcgaggagctctacgccgtcgcgcgcgcg
attgaaacgcaccagatcgaaggcctgctggtcatcggcggctggatggcctacaaggca
gcgtaccagttgcactgcgagcgcgaccgctatcccgccttcaagatcccgatcatctgc
ctgccggcgacgatcgacaacaacctgcccggctcggaactcagcgttggcgccgatagc
gcgctcaacgccattgtcggcgccctcgatcgggtcaagcagtcggcgatggccgccaag
cgctgttttgtggtcgaaaccatgggccgctactgtggctacctggcactgatgagtggt
ctggccggtggcgccgaacgcgtctatctgcacgaggaaggcgtcaccctgaaggacctg
caagccgaagtcgagcatatggtggacgcgttccacactggccgacgactctacctgacc
atacgcaacgagcgagccaacgcgcagtacacgaccgacttcatgtgtgcgctgttcgag
gaggagggtcgcggtctctttgacgtgcgccgttccgtgctgggccatttccagcagggc
ggcaatccctcgccgtacgatcgcattctggcaacgcgactggcggcgcactgcatcagc
ttcctgagtgagcaactggcaagcggctcggcggatggcgccttcattggtctggtcgag
ggcaaggtcacgctcgttccgctcggcaggatgtcggagatggtcgattggacccatttt
cggcccaaggaacagtggtggctggagctgcgaccggtggttcaaacgatggcgcagtcg
atcgcgacggaggcctga

DBGET integrated database retrieval system