KEGG   Accumulibacter phosphatis: CAP2UW1_0254Help
Entry
CAP2UW1_0254      CDS       T00966                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
app  Accumulibacter phosphatis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAP2UW1_0254
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAP2UW1_0254
   00052 Galactose metabolism
    CAP2UW1_0254
   00500 Starch and sucrose metabolism
    CAP2UW1_0254
   00520 Amino sugar and nucleotide sugar metabolism
    CAP2UW1_0254
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CAP2UW1_0254
   00524 Butirosin and neomycin biosynthesis
    CAP2UW1_0254
Enzymes [BR:app01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CAP2UW1_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
309927..310892
Genome map
AA seq 321 aa AA seqDB search
MIPGARLVADIGGTHARFALLDERGLPERVRVLAVADYAGPVEAVQAYLHEFGSPPLRAA
ALALAAPVHADVIRMTNADWVFVRADIMARLGLAQLLLLNDFAALALSLPHLAAADLRQV
GGGTAVALAPKAVLGPGTGLGVSGVFYARGRWLALTGEGGHCSLAPGDRREAEILALAWR
EFAHVSAERLLSGSGLPLLYRLVGEVDGWSGEPLATPEIVARAVSGDDPRCRAVIDTLCA
MLGAMAGNLALTLGAQGGVYVGGGIIPRLGDLFDRSAFRTRFEAKGRFASYLVAIPTYVM
LCPTPALLGSAHALADSEGCP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatccccggtgcgcggctggtagccgacatcggcggcacccacgcccgcttcgcactg
ctcgacgagcgcggcctgccggaacgggtgcgcgtgcttgcggtggccgactacgcgggt
ccggtggaggccgttcaggcctatctccacgagttcggcagcccgcccttgcgcgccgcc
gcgcttgccctggccgccccggtccatgctgacgtgatccgcatgaccaatgccgattgg
gtcttcgtgcgcgccgacatcatggcccgactgggcttggcgcagttgctgctgctcaac
gactttgcggctctcgccctgtcgctgccgcatctcgctgccgccgacctgcgtcaggtt
ggcggtgggaccgccgtcgcgctggcaccgaaggcggtccttgggcccggcaccggtctc
ggtgtctccggcgtgttctacgcgcgcgggcgctggctggccttgacgggagagggcgga
cactgctcgctggcgccgggcgaccggcgcgaggcggagattctggctcttgcctggcgc
gagttcgcgcacgtctcggccgagcgcctgctttccggtagtggcctgccgctgctgtat
cgtctggtcggtgaagtcgatggctggtccggcgaacccctggcgacgcccgagatcgtc
gcccgtgccgtgtctggggacgatccacgctgccgggcagtcatcgataccctgtgcgcg
atgctcggggcaatggcaggaaatcttgccttgacactgggtgcccagggtggcgtgtat
gtcggtggtggtatcattccacggctcggcgacctgtttgatcggtcagcctttcgcacc
cgcttcgaggccaaggggcgcttcgcttcctacttggtcgccatcccgacgtatgtgatg
ctgtgtcctacgccggccctgctgggttctgcccatgctctggccgacagcgagggttgc
ccatga

DBGET integrated database retrieval system