KEGG   Accumulibacter phosphatis: CAP2UW1_0256Help
Entry
CAP2UW1_0256      CDS       T00966                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
app  Accumulibacter phosphatis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CAP2UW1_0256
Enzymes [BR:app01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CAP2UW1_0256
Exosome [BR:app04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CAP2UW1_0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
313380..315563
Genome map
AA seq 727 aa AA seqDB search
MLDTAEIVALCRAEHGDPYAVLGMHVDADGFLWVRSLQPGARSVAVLDAKTGRQLAELEH
REVEGVEGYFEGLIPRRRISFPYRLRIEWENGVQETDDPYRFATVLGEMDVWLLAEGSHL
RPFERLGAHLCEIDGVPGTAFAVWAPDAQRVSVVGDFNTWDGRRHPMRLRRECGVWEIFL
PGVSAGAHYKYEIRSHGGFLLPLKSDPYGFQAEMRPSTASIVCELPPPVDPTSIPAGDLL
GAPMSIYEVHLASWRRADDGGFPDWQRISETLIPYVVGLGFTHIELLPISEHPFDGSWGY
QPLGLYSPTARHGSPTGFRNFVGACHAAGLRVMVDWVPAHFPTDEHGLGRFDGTALYEHA
DPREGMHQDWGTLIYNFGRREVSNYLIGNALFWIERYGIDGLRVDAVASMLYRDYSREEG
QWLPNQYGGRENLEAVAFLRRMNEVLGQEHPAADTHAEESTAWPMVSRPPSMGGLGFHYK
WNMGWMHDVLDYMTKDPVHRRYHHNQLSFGMMYAFTENFVLPLSHDEVVHGKGSLLSKMA
GDYWQKFANLRSLYAFMWAHPGKKLLFMGGEIGQWNEWNHDTSLDWGLLDFPLHAGMHDL
IRDLNGIYRSNPALHEVDFEPAGFEWMAPDDADCSVVAFVRWSRDHSRAVLYVGNFTPVV
RQGYRIGVPVPGGYCERLNTDSQYYGGSNVGNGYEPVYAEYVPAHGREWSVSLTLPPLAG
LYLEWVP
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacactgcagaaattgttgccctttgccgggcagaacacggcgacccctacgcc
gtccttggaatgcacgtcgatgccgacggtttcctgtgggtccgcagcctgcaaccggga
gcgcgctcggttgcagtgctcgacgccaagaccgggaggcagcttgccgaactcgagcac
cgcgaggtcgagggagtcgaaggttacttcgaaggactcatcccccgccgccgcatcagt
tttccctaccggttgcgcatcgagtgggaaaacggcgtgcaggaaaccgatgatccgtat
cgttttgccacggtattgggcgagatggacgtttggctacttgccgagggctcgcacctg
cgacccttcgagcgcctcggcgcgcatctctgcgaaatcgatggcgttcccggcaccgca
ttcgcggtctgggctcccgatgcgcaacgggtcagcgtcgttggcgacttcaatacctgg
gatggtcgtcgccacccgatgcgcctgcgccgcgaatgcggcgtctgggagatcttcctc
ccgggggtcagtgccggcgcccactacaagtacgaaattcgttcccacggcggctttctg
ctgccgctcaagtccgacccttatggctttcaggcggaaatgcggccgtcgacggcgtcg
atcgtctgtgaactgccacccccggtggatccgacgtcgattccggccggcgatctgctg
ggcgcgccgatgtcgatctatgaggtccatctggcgtcgtggcggcgtgccgacgatggc
ggcttccctgactggcagcgaatcagcgagacgctgattccttacgtagttggcctcggc
tttacccatatcgaactgctgccgatttcggagcatccgttcgacggctcctggggctac
cagccgctgggactctactcgccgactgcccgccatggcagcccgaccggctttcgcaat
ttcgtcggtgcctgtcatgccgccggactgcgcgtcatggttgactgggtaccggcgcat
ttcccgaccgacgaacacggtctcggccgcttcgacggcacggcgctgtatgagcacgcc
gatccccgcgaaggcatgcatcaggactggggcacgctgatctacaacttcggccgccgc
gaagtcagcaactatctgatcggcaacgcgctgttctggatcgagcgctacggcatcgac
ggcctgcgcgtcgatgccgtagcgtcgatgctctaccgcgactatagccgcgaggagggg
caatggctgccgaatcagtacggcgggcgcgagaacctcgaagccgtcgccttcctgcgg
cggatgaacgaggttctcggccaggagcacccggccgccgatacgcatgccgaggagtct
actgcctggccgatggtcagtcgcccgccgtcgatgggcggtctcggcttccactacaag
tggaacatgggctggatgcacgacgtcctcgactacatgaccaaggatccggtgcatcgc
cggtatcaccacaatcaactcagcttcgggatgatgtacgcgttcaccgagaacttcgtc
ctgccgctttcgcacgacgaagtcgtgcacggcaagggctcgctgctcagcaagatggcc
ggcgactactggcagaagtttgccaacctgcgttcgctttacgccttcatgtgggcgcat
ccgggcaagaagctgttgttcatgggcggcgaaatcgggcaatggaacgagtggaatcac
gacacgtcgctcgactggggtctgctcgacttccccctgcatgcgggcatgcacgacctg
attcgcgatctgaacggcatctatcgcagtaatccggcactgcacgaggtcgatttcgag
ccggctggtttcgagtggatggcgcccgacgatgccgactgctcggtcgtcgccttcgtc
cgctggtcgcgcgatcactcgcgcgccgttctctatgtcggcaacttcacgccggtcgtc
cgccagggctaccgtatcggcgtgccggtgccgggtggctactgcgagcgcctcaacacc
gattcccagtactacggggggagtaacgtcggcaacggctatgagccggtgtatgcggag
tacgtgccagcgcacggacgggaatggtcggtcagcttgactctgcccccgctcgccggg
ctttatctcgaatgggtcccgtga

DBGET integrated database retrieval system