KEGG   Accumulibacter phosphatis: CAP2UW1_0307Help
Entry
CAP2UW1_0307      CDS       T00966                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
app  Accumulibacter phosphatis
Pathway
app00030  Pentose phosphate pathway
app01100  Metabolic pathways
app01120  Microbial metabolism in diverse environments
app01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CAP2UW1_0307
Enzymes [BR:app01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CAP2UW1_0307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACV33664
JGI: CAP2UW10307
UniProt: C7RK73
Position
369154..371001
Genome map
AA seq 615 aa AA seqDB search
MAWTRKVLRVNLTQGSCVSEPLNMAWAAQYLGQRGLASKYLVSEIDPLVDPLAAENKIIY
ATGPLTGTMASTGGRYSVVTKGPLTGVIACSNSGGFFGAELKAAGWDMIIVEGKSPRPVY
LHIENDKAVLLAAEDLWGRTVWDTEGTLKKRHQDPLLRVSSIGRAGENQVLFAAIVNDLH
RAAGRSGVGAVMGSKNLKAIAVRGTLGVGNIADPKSFMAAVAAGKKVLAENAVTGQGLPT
YGTQVLMNVINEMGASPTRNHRDVQFEGARKISAEAMHEKRTTDGKTHLVTNQACFGCTI
ACGRISRIDETHFSVETKPQYWGASGGLEYEAAWALGNANGVDDLEALQYANLVCNEDGM
DPISFGATVGAVMELYELGILTRDDIGLEAPFGSAEALCRLAEMTARGEGFGKVVGLGSK
RLCTRYGRPDLSMTVKGQEFPAYDGRALQGMGLAYATSNRGACHLRGYMVSSEVFGIPVK
TDPRETAGKPELLKAFQDATAAVDSSGLCVFTTFAWTMNDIQPQIQSACEGDWSLESLLQ
TGERIWNLERDFNLAAGITGKDDTLPPRLLNEPCKTGASKGMVAELGKMLPEYYSLRGWT
PDGVPTAATRARLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggcttggacacgcaaggttcttcgcgttaacctcacccaggggagctgtgtcagcgaa
ccgttgaacatggcttgggcggcgcagtatctcggtcaacgtgggctggccagcaagtat
ctggtcagcgagattgacccgctggtcgacccactggcggcagagaacaagatcatctat
gccaccggcccgctgaccgggacgatggcgtctaccggcggccgctattccgtggtcacc
aaggggccactgaccggtgtcatcgcctgctcgaattccggtggcttcttcggcgccgaa
ctcaaggcggccgggtgggacatgatcatcgtcgagggcaagtccccgcgcccggtctat
ctgcatatcgagaacgacaaggcggtactgcttgccgcggaggatctctggggcaggacc
gtctgggacaccgaaggcacgctcaagaagcgtcaccaggatcccttgctgcgggtgtcc
agcattggtcgcgccggcgagaatcaggtcctcttcgcggcgatcgtcaacgatctgcac
cgcgcagccgggcgctccggtgtcggtgcggtgatgggatcgaagaacctcaaggcgatt
gccgttcgcggtacgcttggggtgggcaacattgccgatccgaagtccttcatggcggca
gtcgctgccggcaagaaggtgctggcagaaaacgccgtgaccgggcaggggctgcccacc
tacggcacgcaggttctgatgaacgtgatcaacgaaatgggtgcttcgccgacccgcaac
catcgcgacgtgcagttcgagggggcacgcaagatctcggctgaagcgatgcacgaaaag
cgcacgacggatggcaagacgcatctcgtcaccaaccaggcctgttttgggtgcacgatc
gcctgcggccggatttcgcgtatcgacgaaacccacttctcggtcgagaccaagccgcag
tattggggggccagtggcggcctcgaatacgaagccgcctgggcgctgggcaatgccaac
ggggtcgacgatctggaggcccttcagtatgccaacctggtgtgcaacgaagacggcatg
gacccgatctcgttcggtgcgacagtcggcgcggtgatggagctttacgaactgggcatc
ctgacccgcgacgacatcggcctcgaggcgcctttcggttccgctgaagcgctctgccgt
ctggccgaaatgaccgcgcgtggcgagggtttcggcaaggtcgtcgggctggggtctaag
cgcctgtgcacgcgctatggccgaccggacttgtcgatgaccgtcaaggggcaggagttc
cccgcgtacgacgggcgtgccctgcagggaatgggtctcgcctatgccacgtcgaaccgt
ggcgcctgccatttgcgcggctatatggtgtcgagcgaggttttcggcatcccggtgaag
accgacccgcgcgagactgccggcaagcccgaactgctgaaggctttccaggatgccact
gccgcggtcgactccagcggcttgtgcgtcttcaccaccttcgcctggacgatgaacgac
attcagccgcagatccagtcggcgtgcgaaggcgactggtcgctggagtcactgctgcag
acgggcgaacgcatctggaatctcgagcgggacttcaacctggcggcaggcatcaccggc
aaggatgacacgctgccgccgcgcctgctcaacgaaccgtgcaagacaggcgcctcgaaa
ggcatggtggccgagctcggcaagatgcttcccgagtactacagcctgcgtggctggacg
cccgacggagtgccgacagcggcgacgcgcgcgcgtctggggctctga

DBGET integrated database retrieval system