KEGG   Accumulibacter phosphatis: CAP2UW1_0313Help
Entry
CAP2UW1_0313      CDS       T00966                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
app  Accumulibacter phosphatis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:app03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
375057..375659
Genome map
AA seq 200 aa AA seqDB search
MNAPSSLESLIEALRCLPGVGPKSAQRMAYHLMQHDRPGADRLADALQLALAALRHCQRC
NTFTETEICSRCLSAKRDPSQLCVVETPVDMNMMEQTHAYSGLYYVLMGRVSPLDGIGPA
ELHLERLLARCGDGLVREVIIATNYTNEGEATAHYLSEMLRSRGVSVSRIARGVPVGGEL
EYVDSGTLAQALRERRPLAG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccccgtcgagtctcgagtcactgatcgaggctttgcgttgtctgccaggcgtt
ggtccaaagtcggctcaacgcatggcctaccatctgatgcagcacgatcggccgggtgcc
gatcgcctggccgatgcgctgcagttggcgctcgctgcgctgcgccattgtcagcgttgc
aataccttcaccgaaaccgagatctgctctcgctgcctctcggcgaagcgcgatcccagc
cagttgtgtgtggtcgaaacgccggtcgacatgaacatgatggagcagacgcacgcctat
tcgggcctgtactacgtcttgatgggtcgcgtctcgccactcgacggtatcgggccagcc
gaactgcacctcgagcggcttctggctcgttgcggtgacgggctggtgcgtgaggtgatc
atcgccaccaactacaccaacgaaggcgaggctacggcacactatctttcggaaatgctc
cgcagccgcggcgtcagcgtgtcgcgaatagcccgtggcgtgccggtcggcggcgagctg
gaatacgtcgattcgggaacgctggcacaggccctgcgtgagcgtcgaccgcttgcaggc
taa

DBGET integrated database retrieval system