KEGG   Accumulibacter phosphatis: CAP2UW1_0486Help
Entry
CAP2UW1_0486      CDS       T00966                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
app  Accumulibacter phosphatis
Pathway
app00010  Glycolysis / Gluconeogenesis
app00051  Fructose and mannose metabolism
app00562  Inositol phosphate metabolism
app01100  Metabolic pathways
app01110  Biosynthesis of secondary metabolites
app01120  Microbial metabolism in diverse environments
app01130  Biosynthesis of antibiotics
app01200  Carbon metabolism
app01230  Biosynthesis of amino acids
Module
app_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
app_M00002  Glycolysis, core module involving three-carbon compounds
app_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAP2UW1_0486
   00051 Fructose and mannose metabolism
    CAP2UW1_0486
   00562 Inositol phosphate metabolism
    CAP2UW1_0486
Enzymes [BR:app01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CAP2UW1_0486
Exosome [BR:app04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CAP2UW1_0486
  Exosomal proteins of bladder cancer cells
   CAP2UW1_0486
  Exosomal proteins of melanoma cells
   CAP2UW1_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACV33837
JGI: CAP2UW10486
UniProt: C7RL15
Position
complement(583531..584298)
Genome map
AA seq 255 aa AA seqDB search
MRKIVIAGNWKMNKTVAESVKLAADVVAAARDIKNVVVAIAPTYLALAKVAEVVKGSNVK
LAAQDVHWENQGAFTGKVSADMLKEIGVDFVIIGHSEQRSYFGETDETVNKKVKKALSLD
MGPIICIGETLAERKGGQLESVLTTQVNGAYAGLSADDALRTVVAYEPVWAIGTGVTATD
DEAQQAHAFVRGLLAKLYGDGVAQSISIQYGGSMKPENAAGLLAQKDIDGGLIGGAALKA
DSFLGIVTPGESISK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaatcgttatcgccggcaactggaagatgaacaagaccgttgccgaatccgtg
aagctcgccgccgatgtggtagctgccgccagggacatcaagaacgtcgtcgtcgccatt
gcgcccacctatctcgctctggcgaaggtggccgaagtggtcaagggaagcaatgtcaag
ctcgccgcccaggatgtccactgggaaaaccagggggccttcaccggcaaggtaagcgcc
gacatgctcaaggagatcggggtcgacttcgtcatcatcggtcactccgagcagcgcagc
tacttcggcgaaaccgacgagaccgtcaacaagaaggtcaagaaggctctctcgctggac
atggggccgatcatctgcattggcgaaacactcgccgagcgcaagggcggccaactcgag
agcgttctcaccacacaggtgaacggcgcctatgccggactctctgctgacgatgcgctg
cgcaccgtcgttgcctacgagccggtgtgggcgatcggcaccggcgtcaccgccaccgat
gacgaggcccagcaagcacacgccttcgtccgcggcctgctcgccaagctctatggtgat
ggcgtcgcccaatcgatcagcatccagtatggcggatcgatgaaaccggagaatgcagcc
ggtctgctcgctcagaaggacatcgacggcggcctgatcggtggcgccgcgctcaaggca
gacagcttcctgggcatcgtcacgccgggcgaatcgatcagcaagtaa

DBGET integrated database retrieval system