KEGG   Accumulibacter phosphatis: CAP2UW1_0486Help
Entry
CAP2UW1_0486      CDS       T00966                                 

Definition
(RefSeq) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
app  Accumulibacter phosphatis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAP2UW1_0486
   01230 Biosynthesis of amino acids
    CAP2UW1_0486
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAP2UW1_0486
   00051 Fructose and mannose metabolism
    CAP2UW1_0486
   00562 Inositol phosphate metabolism
    CAP2UW1_0486
Enzymes [BR:app01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CAP2UW1_0486
Exosome [BR:app04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CAP2UW1_0486
  Exosomal proteins of bladder cancer cells
   CAP2UW1_0486
  Exosomal proteins of melanoma cells
   CAP2UW1_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(583531..584298)
Genome map
AA seq 255 aa AA seqDB search
MRKIVIAGNWKMNKTVAESVKLAADVVAAARDIKNVVVAIAPTYLALAKVAEVVKGSNVK
LAAQDVHWENQGAFTGKVSADMLKEIGVDFVIIGHSEQRSYFGETDETVNKKVKKALSLD
MGPIICIGETLAERKGGQLESVLTTQVNGAYAGLSADDALRTVVAYEPVWAIGTGVTATD
DEAQQAHAFVRGLLAKLYGDGVAQSISIQYGGSMKPENAAGLLAQKDIDGGLIGGAALKA
DSFLGIVTPGESISK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaatcgttatcgccggcaactggaagatgaacaagaccgttgccgaatccgtg
aagctcgccgccgatgtggtagctgccgccagggacatcaagaacgtcgtcgtcgccatt
gcgcccacctatctcgctctggcgaaggtggccgaagtggtcaagggaagcaatgtcaag
ctcgccgcccaggatgtccactgggaaaaccagggggccttcaccggcaaggtaagcgcc
gacatgctcaaggagatcggggtcgacttcgtcatcatcggtcactccgagcagcgcagc
tacttcggcgaaaccgacgagaccgtcaacaagaaggtcaagaaggctctctcgctggac
atggggccgatcatctgcattggcgaaacactcgccgagcgcaagggcggccaactcgag
agcgttctcaccacacaggtgaacggcgcctatgccggactctctgctgacgatgcgctg
cgcaccgtcgttgcctacgagccggtgtgggcgatcggcaccggcgtcaccgccaccgat
gacgaggcccagcaagcacacgccttcgtccgcggcctgctcgccaagctctatggtgat
ggcgtcgcccaatcgatcagcatccagtatggcggatcgatgaaaccggagaatgcagcc
ggtctgctcgctcagaaggacatcgacggcggcctgatcggtggcgccgcgctcaaggca
gacagcttcctgggcatcgtcacgccgggcgaatcgatcagcaagtaa

DBGET integrated database retrieval system