KEGG   Accumulibacter phosphatis: CAP2UW1_0514Help
Entry
CAP2UW1_0514      CDS       T00966                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
app  Accumulibacter phosphatis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CAP2UW1_0514
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAP2UW1_0514
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CAP2UW1_0514
Enzymes [BR:app01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CAP2UW1_0514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(620017..621504)
Genome map
AA seq 495 aa AA seqDB search
MRYISTRGNPPSTADSSGPTFCQILLGGLAPDGGLYLPDHYPQVSRTELDQWRGMAYADL
AHAVLTKFIDDIPLDDLARLVARTYTAEAYGNGRVSAQASDITPLRWLEPPDPAQREAGL
AILELSNGPTLAFKDMAMQLLGNLFEYVLARQGEEINILGATSGDTGSSAEYALRGKKGV
RVFMLSPHERMSAFQRAQMYSLHDENIHNIAVRGMFDDAQDIVKAVSNDHAFKARYRIGA
VNSINWARVAAQVVYYFKGYFAATGGIAGSNDQQVAFAVPSGNFGNICAGHVARMMGLPI
GRLVLATNENDVLDEFFRTGVYRPRAAAETSATSSPSMDISKASNFERFVFDLVGRDPAV
IRRLWAEVDAGGSFDLSGTPFFARLPEFGFVSGRSTHADRLATIRQTFGQYGLMIDTHTA
DGLKVASEWRTPEMPMVVLETALPAKFEETIVEALGCKPERPPGLQGIESLPQRFAVIDV
SVDAVKELIAQGVHA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacatttcgactcgcggcaatccccccagcacggcggattcatccggtccgacc
ttctgccagattctgcttggcgggctcgctccagatggcggcctctacctgccggaccac
tatccgcaggtcagcaggaccgagctcgatcaatggcggggaatggcctatgccgatttg
gcgcatgccgtactgaccaagttcatcgacgatatcccgctcgacgatctggcgcgcctg
gttgcgcgtacctatactgccgaggcgtacggcaacgggcgtgtcagtgcgcaggcgagc
gacatcacgcccttgcgctggctggaaccgcccgacccggcgcagcgagaagccgggctg
gcgatcctcgaactgtccaacgggccgacgctggccttcaaggacatggccatgcagttg
ctcggcaatctgttcgaatacgttctcgccaggcagggcgaagagatcaatattctcggg
gccacttccggcgataccggttcgtctgccgagtacgccttgcgggggaagaaaggcgtg
cgcgtcttcatgctttccccacatgagcgaatgagcgcctttcaacgtgcgcagatgtac
tcgctccacgatgaaaacatccacaacatagccgtgcgcggcatgttcgacgacgcccag
gacatcgtcaaggcagtgtccaacgatcacgctttcaaggccaggtaccggattggtgct
gtcaattcgatcaactgggcacgtgtcgccgctcaggtcgtctactacttcaagggctac
ttcgcggcgaccggcggcatcgccggcagcaacgatcagcaggtcgcttttgcggtaccg
tccggcaacttcggcaacatctgtgccggccacgtagcgcgcatgatggggttgccgatc
ggccgtctggtcctggccaccaatgaaaacgacgtgctcgacgagttcttccgcaccggg
gtctatcggccgcgcgcggctgccgagacctctgctacgtcgagtccatcgatggacatc
tcaaaggcgtcgaacttcgagcgctttgtcttcgatctggttggacgcgacccggcggtg
attcgccgactgtgggcggaggtcgacgctggcggcagcttcgacctttcaggcacgcct
ttctttgcccgccttcccgaatttggctttgtttcgggcaggagcacgcacgccgaccgt
ctggcgacgatccgccagacatttgggcagtacggtctgatgatcgatacccataccgcc
gacggactcaaggtggcgagcgagtggcgaacgccggagatgccgatggtcgtcctcgag
acggccttgccggcaaagttcgaggagacgatcgtcgaagccctcgggtgcaagcccgaa
aggcctcccggcctgcagggcatcgaaagcctgccgcagcggtttgcggtgatcgacgtg
agcgtcgacgcggtcaaagagttgatcgcgcaaggcgtccacgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system