KEGG   Accumulibacter phosphatis: CAP2UW1_0514Help
Entry
CAP2UW1_0514      CDS       T00966                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
app  Accumulibacter phosphatis
Pathway
app00260  Glycine, serine and threonine metabolism
app00750  Vitamin B6 metabolism
app01100  Metabolic pathways
app01110  Biosynthesis of secondary metabolites
app01120  Microbial metabolism in diverse environments
app01230  Biosynthesis of amino acids
Module
app_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAP2UW1_0514
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CAP2UW1_0514
Enzymes [BR:app01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CAP2UW1_0514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACV33865
JGI: CAP2UW10514
UniProt: C7RL43
Position
complement(620017..621504)
Genome map
AA seq 495 aa AA seqDB search
MRYISTRGNPPSTADSSGPTFCQILLGGLAPDGGLYLPDHYPQVSRTELDQWRGMAYADL
AHAVLTKFIDDIPLDDLARLVARTYTAEAYGNGRVSAQASDITPLRWLEPPDPAQREAGL
AILELSNGPTLAFKDMAMQLLGNLFEYVLARQGEEINILGATSGDTGSSAEYALRGKKGV
RVFMLSPHERMSAFQRAQMYSLHDENIHNIAVRGMFDDAQDIVKAVSNDHAFKARYRIGA
VNSINWARVAAQVVYYFKGYFAATGGIAGSNDQQVAFAVPSGNFGNICAGHVARMMGLPI
GRLVLATNENDVLDEFFRTGVYRPRAAAETSATSSPSMDISKASNFERFVFDLVGRDPAV
IRRLWAEVDAGGSFDLSGTPFFARLPEFGFVSGRSTHADRLATIRQTFGQYGLMIDTHTA
DGLKVASEWRTPEMPMVVLETALPAKFEETIVEALGCKPERPPGLQGIESLPQRFAVIDV
SVDAVKELIAQGVHA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacatttcgactcgcggcaatccccccagcacggcggattcatccggtccgacc
ttctgccagattctgcttggcgggctcgctccagatggcggcctctacctgccggaccac
tatccgcaggtcagcaggaccgagctcgatcaatggcggggaatggcctatgccgatttg
gcgcatgccgtactgaccaagttcatcgacgatatcccgctcgacgatctggcgcgcctg
gttgcgcgtacctatactgccgaggcgtacggcaacgggcgtgtcagtgcgcaggcgagc
gacatcacgcccttgcgctggctggaaccgcccgacccggcgcagcgagaagccgggctg
gcgatcctcgaactgtccaacgggccgacgctggccttcaaggacatggccatgcagttg
ctcggcaatctgttcgaatacgttctcgccaggcagggcgaagagatcaatattctcggg
gccacttccggcgataccggttcgtctgccgagtacgccttgcgggggaagaaaggcgtg
cgcgtcttcatgctttccccacatgagcgaatgagcgcctttcaacgtgcgcagatgtac
tcgctccacgatgaaaacatccacaacatagccgtgcgcggcatgttcgacgacgcccag
gacatcgtcaaggcagtgtccaacgatcacgctttcaaggccaggtaccggattggtgct
gtcaattcgatcaactgggcacgtgtcgccgctcaggtcgtctactacttcaagggctac
ttcgcggcgaccggcggcatcgccggcagcaacgatcagcaggtcgcttttgcggtaccg
tccggcaacttcggcaacatctgtgccggccacgtagcgcgcatgatggggttgccgatc
ggccgtctggtcctggccaccaatgaaaacgacgtgctcgacgagttcttccgcaccggg
gtctatcggccgcgcgcggctgccgagacctctgctacgtcgagtccatcgatggacatc
tcaaaggcgtcgaacttcgagcgctttgtcttcgatctggttggacgcgacccggcggtg
attcgccgactgtgggcggaggtcgacgctggcggcagcttcgacctttcaggcacgcct
ttctttgcccgccttcccgaatttggctttgtttcgggcaggagcacgcacgccgaccgt
ctggcgacgatccgccagacatttgggcagtacggtctgatgatcgatacccataccgcc
gacggactcaaggtggcgagcgagtggcgaacgccggagatgccgatggtcgtcctcgag
acggccttgccggcaaagttcgaggagacgatcgtcgaagccctcgggtgcaagcccgaa
aggcctcccggcctgcagggcatcgaaagcctgccgcagcggtttgcggtgatcgacgtg
agcgtcgacgcggtcaaagagttgatcgcgcaaggcgtccacgcctga

DBGET integrated database retrieval system