KEGG   Accumulibacter phosphatis: CAP2UW1_0562Help
Entry
CAP2UW1_0562      CDS       T00966                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
app  Accumulibacter phosphatis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:app00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:app00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
678463..678972
Genome map
AA seq 169 aa AA seqDB search
MISLIAAVARNGAIGRNQQLLWRLPEDMRYFRETTSGKTVIMGRKTWESLPPAYRPLPNR
RNIVLSRNPAYLPRGGDLACSIEDALRLAGGAAEVFIIGGEELYRQTMPLATRLYITEVA
EESPGDAFFPDVASGEWREISRRVGRSRAAGSALRDQAPAFDFVVYERR
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgatttccctgatcgctgccgtggcgcgcaacggagccatcggccggaatcagcagttg
ctgtggcgtctgcccgaagacatgcgctactttcgcgagacgaccagtggcaagacggtg
atcatgggcagaaagacctgggaatccttgccgccagcgtatcggccgctgcccaaccgg
cgcaacatcgtgctgagccgcaatccggcctacctgccgcgcggcggggatctggcctgc
tcgatcgaagacgcgctgcgtctggccggcggcgccgccgaggtcttcatcatcggtggt
gaggagctttatcggcagaccatgccgctcgcgacgcgcctctacatcaccgaagtcgcc
gaggagtctcctggcgacgctttctttccggatgtcgcgtctggcgaatggcgggaaatc
tcgcggcgggtgggcaggagtcgcgccgcgggcagtgcccttcgagaccaggctcccgct
ttcgacttcgtggtctacgagcgccgctga

DBGET integrated database retrieval system