KEGG   Accumulibacter phosphatis: CAP2UW1_0576Help
Entry
CAP2UW1_0576      CDS       T00966                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
app  Accumulibacter phosphatis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CAP2UW1_0576
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CAP2UW1_0576
Enzymes [BR:app01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     CAP2UW1_0576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(692361..693869)
Genome map
AA seq 502 aa AA seqDB search
MRAVASPARSEADTAALQRLATLGVVPGGVTDDSRQVRPGDLFLAYPGDVADGRRYIAEA
IANGAVAVFWEPAPAGTPDFAWNRTWQVANLAVAGLRELCGPLANAIYGRPSERLSLIAV
TGTNGKTSVSQWIAATHPRRCAVIGTLGAGMPGQLVETGFTTPAATTLMRYLASFAHDDA
QACALEASSIGIAEGRLDGARVDVAVFTNLTRDHLDYHATMAAYAQAKARLFAWPRLRLA
VSNLDDPFGRELAALSTATKVIGYTQQAGADDRQGTIRAENIEETIDGLRFRLCAPNGRA
LVESGLLGRYNVSNLLAVAAVLIDAGLTPKAVAERFAQLSSPPGRLEKIGGHNEPLVIVD
YAHTPDALESALMALRPVANARGAGLVVIFGCGGDRDRGKRPLMAAVAARHADRVVLTSD
NPRSENEHAILADILAGAPTALVIADRGEAIRRTLLAAHPADVVLIAGKGHEPYQEIAGV
RRPFSDGAQARAALADRQEPAQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgagggccgtggcaagtcctgcgcgtagcgaggccgatacggccgccctgcagcggctg
gcaaccctcggcgtcgtacccggtggggtgaccgacgacagccgccaagtgcgcccgggc
gacctcttcctggcctaccccggcgatgtggccgacggtcgccgctacatcgccgaggca
attgccaacggcgccgttgccgtcttctgggaaccggctccggccggcacgcctgatttt
gcctggaaccgcacatggcaggtcgccaatctcgcggtggctggcttgcgagagctttgc
gggcctctggccaacgccatctacgggcgaccgagcgagcgcctgtcgctgatcgccgtc
accggtaccaacggcaagaccagcgtcagccagtggattgccgccacccacccgcgccgc
tgcgccgtgattggcacgctgggcgcaggtatgcccggccagttggtggaaaccggtttc
accacgccggcagcgacgaccctgatgcgctatctggccagctttgcccatgacgatgcc
caggcatgtgcgctcgaggccagttcgatcggcattgccgaggggcgcctcgacggggcc
cgcgtcgacgtagcggtgtttaccaacctcacccgcgatcacctggattaccacgcaacg
atggccgcctatgcgcaggccaaggcaagactctttgcctggccaagactgcgcctggcg
gtgagcaatctcgatgatcccttcgggcgtgaactggccgccctgagcaccgcgaccaag
gtcatcggctatacgcagcaggcaggcgccgacgaccggcaagggacgatccgggccgag
aacatcgaggaaacgatcgacgggctgcgttttcgtctctgcgcgcccaacggtcgtgcc
ctcgtcgagagcgggctgctcggccgctacaacgtctccaacctgctggcggttgccgcc
gtgctgatcgacgccggcctgacgcccaaggccgtcgcggaacgtttcgcgcagttgagc
tcgccgccgggtcgtctcgaaaagatcggcggccacaacgagccgttggtgatcgtcgac
tacgcgcatacccccgatgccctggaaagtgccctcatggcgctgcgcccggtggccaat
gcgcgcggcgccggtctggtcgtcatcttcggctgtggcggcgatcgggatcgcggcaag
cgacccctgatggcagcggttgccgcccgccacgccgatcgcgtcgtgttgaccagcgac
aatccacgcagcgaaaacgagcacgccatcctcgcggacattctcgccggggcgccgacg
gcgctggtcatcgccgatcgcggcgaagcgattcgtcgcaccttgcttgcggcacatccc
gccgacgttgtcctgatcgccggcaaggggcacgagccgtaccaggaaatcgccggcgtc
cggcgtccgttctcggacggcgcgcaggcgcgcgccgcgctggccgaccgccaggaaccg
gcccagtga

DBGET integrated database retrieval system