KEGG   Accumulibacter phosphatis: CAP2UW1_0612Help
Entry
CAP2UW1_0612      CDS       T00966                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
app  Accumulibacter phosphatis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CAP2UW1_0612
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CAP2UW1_0612
Enzymes [BR:app01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     CAP2UW1_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(728100..729365)
Genome map
AA seq 421 aa AA seqDB search
MDKLLIEGGTPLAGEIAISGAKNAALPILCACLLTAEPLHLTNVPRLRDIATMLRLIEQM
GVAVTHDGANGVVLDSSGLSNPLAPYDMVKTMRASILVLGPLLARHGEARVSLPGGCAIG
ARPVEQHILGLQAMGASIHVEHGYIQAGAGTGKRGLRGACIVTDMVTVTGTENLMMAAAL
ADGETIIENAAREPEVVDLANCLVSMGAQISGAGTDKIRIRGVERLHGATHRIMADRIET
GTYLCAAAASGGSVRLTGTSAAYLDAVVDKLLDAGCDIVAERDAIRLKAPPRLKAVSIRT
SPYPAFPTDMQAQFMAINCVAEGSAVIRETIFENRFMHAVELIRLGADIRIDASNAMVTG
VERLQGATVMATDLRASASLVIAGLVAQGETLIDRIYHLDRGYEGIEEKLGQLGARVRRI
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtggataagctgctgattgagggtggcacacccctggccggcgagatcgccatctccggc
gcaaaaaatgcggcgctgccgatcctctgcgcctgcctgctgacggcagaacctctgcat
ctcaccaacgtgccccggctcagggacatcgcaaccatgctgcgcctgatcgagcaaatg
ggcgtcgcggtcacgcacgatggcgccaatggggtggtactggacagcagcggactcagc
aacccgctggcgccttacgacatggtcaagacgatgcgggcgtcgatcctggtcctcggc
cccctcctggcacgccatggcgaagccagggtgtcgctgccgggcggttgcgcaatcggc
gcgcggccggtcgaacagcacattctcggactgcaggccatgggcgcctcgattcacgtc
gagcacggctatatccaggccggggcagggacaggcaagcgcggactacgaggcgcctgc
atcgtcaccgacatggtcacggtgaccgggacggagaacctgatgatggcggctgcactg
gccgacggcgaaacaatcatcgaaaatgccgcgcgcgaaccggaggttgtcgacctggcc
aactgtctggtgtcgatgggggcacagatttccggcgccggtaccgacaagattcgcatc
cgcggtgtcgaacgcctgcacggcgcaacacaccggatcatggccgaccgcatcgaaacg
ggaacgtacctttgcgctgctgccgccagtggtggcagcgttcgcctgacgggaacttcg
gcggcctacctcgacgcggtagtcgataagctgctcgacgccggctgcgacatcgtcgcc
gagcgcgatgcgatcaggctcaaggctccgccgcggctgaaggcggtcagcatccgtacc
tcaccctacccggcctttccgaccgacatgcaggcacagttcatggccatcaactgtgtc
gccgagggatcggcggtgatccgcgagacgatcttcgagaaccgcttcatgcacgccgtc
gagctgattcgcctcggagccgacatccgtatcgacgccagcaacgccatggtcaccggc
gtcgagcgtcttcagggcgcgacggtaatggctaccgacctgcgtgcgtcggccagcctg
gtcatcgccggcctggtcgcccagggcgagactctgatcgaccgcatttaccatctggac
cggggttatgaaggcatcgaggagaaactcggccagcttggggcgcgcgtcaggcggatt
cgctga

DBGET integrated database retrieval system