KEGG   Accumulibacter phosphatis: CAP2UW1_0672Help
Entry
CAP2UW1_0672      CDS       T00966                                 

Definition
N6 adenine-specific DNA methyltransferase, N12 class
Orthology
K07317  
adenine-specific DNA-methyltransferase [EC:2.1.1.72]
Organism
app  Accumulibacter phosphatis
Brite
Enzymes [BR:app01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     CAP2UW1_0672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
795898..797160
Genome map
AA seq 420 aa AA seqDB search
MSRPPKTVESPPSTPPTHDIGRLGQVFTPTSVVDSMLALVRNRGRVLEPACGDGVFLQHF
PFAVGIEIDPRHAPPGARVMDFFDLSERESFATIIGNPPYVRYQDIPAASRGRVRRSVLD
GRANLYLFFIEKCLRHLAPGGELVFITPRDFVKATSAVPLNRVLHAAGTITDFVELGDSR
LFDGATPNCAIWRFELGNFSRLTHYAAQGFADGIAGLGRLQWEERHFVESGGHLLFTRGD
YALHLTDIAFVKVGAVSGADDLYASEEYGNRSFVYSGTLASGKTRRMLWCEPGEAPPAVL
LPHKTRLIARRIRPFDESNWWHWGRGYHQSTQPRVYVNNKTRRSRPFFVHCCNHYDGAVL
AIFPRDPAVDVRALAEALNVVDWEDLGFVCDGRFLFAQRSLEQTPLPESFRAFLPQRGVK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtccgccgaaaacagtcgagtctccgccgtcgactccacccacgcacgacatc
ggccgcctcggacaggtgttcacgccgacgtcggtcgtcgacagcatgcttgcgctggtg
cgcaaccgtggccgggtgctcgagccggcttgcggcgacggcgttttcctgcagcatttt
ccgtttgcggtcggcatcgagatcgatccacggcatgcgccgccgggggcgcgcgtgatg
gatttcttcgacctgtcggagcgcgagtctttcgcgacgatcatcggcaatccgccgtac
gtgcgctaccaggacataccggccgcctcgcgtggccgggtcaggcgcagcgttctcgac
gggcgcgccaacctctacctgttcttcatcgagaagtgtctcaggcatctggcaccgggc
ggcgaactcgtcttcatcacgccgcgcgatttcgtcaaggcgacctccgccgtgccgctc
aaccgcgtgctgcatgccgcgggaacgatcacggatttcgtcgagctcggcgattccagg
ctgtttgacggtgccacgccgaattgcgcgatctggcggttcgaactcggcaacttttcg
cggttgacgcactatgccgcccagggctttgccgacggcatcgccggcctggggcgattg
cagtgggaggagcgccacttcgtcgagagcggtggtcacctcttgttcacgcgcggcgac
tatgcgctgcacctgacggacatcgctttcgtcaaggtcggcgcggtgtccggcgccgat
gatctttacgccagcgaggagtacgggaatcgcagtttcgtctactcggggacgctcgcc
agcgggaagacgcgccggatgctctggtgcgagcctggcgaagcgccgccggccgtcttg
ctgccgcacaagactcgcctgatcgctcgccgcatccggccgtttgacgaatccaactgg
tggcactggggacgtggctaccatcagtcgacgcagccacgggtttacgtcaacaacaag
acacgccgctcgcggcccttcttcgtgcattgctgcaatcactatgacggagcggtactg
gcgattttcccgcgcgacccggccgtcgatgtgcgggcactggccgaggcgctgaatgtt
gtcgactgggaggacctcggtttcgtctgcgacggccgttttctcttcgctcagcgcagt
ctcgagcagacgccgctgcccgagtcgttccgtgccttcctgccgcaacgcggtgtaaaa
tag

DBGET integrated database retrieval system