KEGG   Accumulibacter phosphatis: CAP2UW1_0682Help
Entry
CAP2UW1_0682      CDS       T00966                                 

Definition
Uracil-DNA glycosylase superfamily protein
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
app  Accumulibacter phosphatis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:app00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    CAP2UW1_0682
Enzymes [BR:app01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     CAP2UW1_0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
806293..807030
Genome map
AA seq 245 aa AA seqDB search
MLKLTDPPVVTELIAAARLLSGRLATLRFSPPVSHVYNPLTYAWAAHEAYLRRYAASRRR
VLFLGMNPGPFGMVQCGVPFGEIAAVRDWLGIECAVRQPAVENPARPIEGFACLRSEVSG
RRLWGLFQERFGSADAFFVEHFVANYCPLAFFNHARNVTPDKLPAAEAAPLHAACDAHLR
AIVAALQPEWVIGVGSFAEARAVAALAGTRVRTGRVLHPSPASPIANRGWAEAATRQLRA
LDVWE
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaattgactgaccctccggtcgttacggaacttattgccgccgcgcggttgctc
tcgggaagactcgcgacgctgcgcttctcgccgccggtgagccacgtgtacaaccccctg
acctacgcctgggcggcgcatgaggcctacttgcgccgttacgcggcaagccgcaggaga
gtgttgtttctcggtatgaatcccggccccttcggaatggttcagtgcggcgtgccgttc
ggtgagatcgccgcggtgcgtgactggctggggatcgagtgtgcggtgcggcaacccgca
gtcgagaatcccgcgcggccgatcgaaggcttcgcctgcttgcgttcggaggtcagcggg
cgtcgcttgtggggactctttcaggagcgtttcggcagcgccgatgccttttttgtcgag
catttcgttgccaactactgccccctggcttttttcaaccacgcccgcaatgtgaccccg
gacaagctgccggcagccgaggcggcgccgctgcatgcggcctgcgacgcgcatctgcga
gccatcgtcgccgctttgcagccggaatgggtgattggcgtgggcagcttcgccgaagcg
cgagcggtcgctgccctggccggaacaagggtcagaacggggcgagtgctgcaccctagt
ccggcgagtcctattgccaaccgcggctgggccgaagccgcaaccaggcaacttcgggcg
ctcgacgtttgggagtga

DBGET integrated database retrieval system