KEGG   Accumulibacter phosphatis: CAP2UW1_0792Help
Entry
CAP2UW1_0792      CDS       T00966                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
app  Accumulibacter phosphatis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CAP2UW1_0792
Enzymes [BR:app01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CAP2UW1_0792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
917774..918550
Genome map
AA seq 258 aa AA seqDB search
MSELLRGKRIAVTRPRAQAARLAAWITEQGGEPVLCPLLEIAPAEEQAPLQAAIAQLDVY
SLAVFISPNAVAFSVPVILAGRRWPEALQAVAIGQSTVDLLAAHGIENTLAPRERFDSEA
VLELPELQAQRVAGKRALLLRGNGGRELLADTLRARGADVDLVSCYRRSAPADAGPLQAL
LHADELDALTVSSSEGLRNLVDLLDGPARARLRQTPLFVPHQRIAEVAAGLGLQGVILTG
PADAGILAALIAYRWRQP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagttgctgcgcggcaagagaattgcggtgacccgtccgcgggcacaagcggcg
aggctggccgcctggattaccgaacaggggggcgagccggtactctgtcccctgctggag
attgctccggccgaggagcaggcaccattgcaggcggcgattgcgcagctcgacgtctac
tcactggccgttttcatcagtccgaacgcagtggctttcagcgtgccggtgatactcgcc
ggccgtcgatggccagaggctctgcaggcggtcgccatcggtcagagtaccgtcgatctg
cttgccgctcatggcatcgagaatacgctcgctccgcgcgagcgtttcgattccgaagcc
gtgctcgaacttccggaattgcaggcgcagcgcgtggcaggcaagcgggcgctgctcttg
cgcggcaacggtgggcgcgaactgctggccgatacgctgcgtgcgcgaggtgccgacgtg
gatctcgtctcctgttaccggcgttcggcgccagccgacgcggggccgctgcaggcgctg
ttgcacgccgacgagcttgatgcgctgacggtttcatcaagcgaggggctgcgcaatctg
gtcgatttgctggatggcccggcgcgcgcacgcctgcgtcagacgccgctgttcgtaccc
catcaacgaatcgccgaggtggcagcagggctcggcctgcagggtgtgatcctcaccggg
ccagccgacgccgggatccttgcagccttgatcgcgtatcgttggcggcaaccatga

DBGET integrated database retrieval system