KEGG   Accumulibacter phosphatis: CAP2UW1_0932Help
Entry
CAP2UW1_0932      CDS       T00966                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
app  Accumulibacter phosphatis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:app00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1073052..1073663)
Genome map
AA seq 203 aa AA seqDB search
MTGHLYIVTAPSGAGKTTLVRLLLENDPGIRLSISHTTRAPRAGERNGIEYHFTDVPDFL
DKVREGEFLEWAEVHGNYYGTSRSGIEAALHAGQDVLLEIDWQGAQQVRRWFPAAIGVFV
LPPSLDELARRLRQRATDSAEIIARRVTAAREEMRHVGEFDYVIINDELPRALHDLLAVV
AASRLRYAAQSQRHAILFSTLLA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgactggacatctctacatcgtcaccgccccctccggcgccggcaagacgaccctggtg
cggttgctgctcgagaacgatcccggcattcgcctgtcaatttctcacacgacgcgcgca
ccgcgcgctggcgaaaggaacggtatcgagtaccacttcacggacgtgccggactttctc
gacaaggttcgtgagggcgagttcctcgaatgggcagaagtgcatggcaactactatggc
acatcgagaagcggcatcgaagctgccctgcacgcaggccaggacgttctgctggagatc
gactggcagggtgcgcagcaggtgcgcagatggttcccggcggccattggcgtgttcgtc
ctgccgccttcgctcgatgaactggcgcgtcggctgcgccagcgggcgaccgacagtgcc
gagatcattgctcgtcgggtcaccgcggctcgtgaggagatgcggcatgtcggcgaattc
gactatgttattatcaacgacgaattgccacgtgcgttacacgatctgttggcggtcgtg
gcggcttcgcgactccgctatgcagcgcaaagccaacgccacgccatcctgttctcaaca
ctgcttgcttga

DBGET integrated database retrieval system