KEGG   Accumulibacter phosphatis: CAP2UW1_0932Help
Entry
CAP2UW1_0932      CDS       T00966                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
app  Accumulibacter phosphatis
Pathway
app00230  Purine metabolism
app01100  Metabolic pathways
Module
app_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CAP2UW1_0932
Enzymes [BR:app01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CAP2UW1_0932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 AAA_22 MMR_HSR1 cobW ABC_tran AAA_30 NTPase_1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACV34269
JGI: CAP2UW10932
UniProt: C7RPM6
Position
complement(1073052..1073663)
Genome map
AA seq 203 aa AA seqDB search
MTGHLYIVTAPSGAGKTTLVRLLLENDPGIRLSISHTTRAPRAGERNGIEYHFTDVPDFL
DKVREGEFLEWAEVHGNYYGTSRSGIEAALHAGQDVLLEIDWQGAQQVRRWFPAAIGVFV
LPPSLDELARRLRQRATDSAEIIARRVTAAREEMRHVGEFDYVIINDELPRALHDLLAVV
AASRLRYAAQSQRHAILFSTLLA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgactggacatctctacatcgtcaccgccccctccggcgccggcaagacgaccctggtg
cggttgctgctcgagaacgatcccggcattcgcctgtcaatttctcacacgacgcgcgca
ccgcgcgctggcgaaaggaacggtatcgagtaccacttcacggacgtgccggactttctc
gacaaggttcgtgagggcgagttcctcgaatgggcagaagtgcatggcaactactatggc
acatcgagaagcggcatcgaagctgccctgcacgcaggccaggacgttctgctggagatc
gactggcagggtgcgcagcaggtgcgcagatggttcccggcggccattggcgtgttcgtc
ctgccgccttcgctcgatgaactggcgcgtcggctgcgccagcgggcgaccgacagtgcc
gagatcattgctcgtcgggtcaccgcggctcgtgaggagatgcggcatgtcggcgaattc
gactatgttattatcaacgacgaattgccacgtgcgttacacgatctgttggcggtcgtg
gcggcttcgcgactccgctatgcagcgcaaagccaacgccacgccatcctgttctcaaca
ctgcttgcttga

DBGET integrated database retrieval system