KEGG   Accumulibacter phosphatis: CAP2UW1_0953Help
Entry
CAP2UW1_0953      CDS       T00966                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
app  Accumulibacter phosphatis
Brite
Enzymes [BR:app01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CAP2UW1_0953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1094362..1095366)
Genome map
AA seq 334 aa AA seqDB search
MKWTLRRWLVLAGLATGLLACSSMPPDGVGYARSSALPAPPDPPDNPTTPEKAALGKQLF
FDKRLSGDGSMACQGCHFRHLGWTDALPLSRKVGGGMNTRHTPTVYNTGYYTAWYWDGRA
KTLEGQITAAWKAQIGADPAKATAVIAAVPGYQAGFQKVFGAAPSEENIAKALAAFLRTL
NSGEAPWDRYAAGDKTAVSADAAAGAELFTGKAGCAACHRPPLYSDGMFYNVGLEAGKAQ
PDLGRFAVSKDPADTSAFKTPTLRSVGISGPYFHDGSVASLEEAVRYMAAGGKADPHKSQ
ILIDRKLSEKEIGQLVAFLNTLTSEESFAPPKLP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggactttgcgtcgctggcttgtccttgccggactggccaccgggctgctcgcc
tgcagcagcatgccaccggacggtgtcggctatgcccgctcgtcagcgctacccgcaccg
ccggatccaccggacaacccgacgacgccggagaaagccgcgctcggcaagcagctcttc
ttcgacaaacgtctctcgggcgatggcagcatggcctgccagggctgccacttccggcac
cttgggtggaccgacgcactgccgctgtcgcgcaaggtcgggggtggcatgaacacccgc
catacgcccaccgtctataacaccggctattacaccgcgtggtactgggacggccgcgcc
aagactcttgaaggccagatcacggccgcctggaaggctcagatcggtgccgacccggcc
aaggccaccgccgtcatcgctgccgttcccggctatcaggcggggttccagaaggtcttc
ggcgccgcacccagcgaggagaacattgccaaggcgctcgccgccttcctgcgcacactg
aacagcggcgaagcgccatgggatcgctatgccgccggcgacaagacggccgtctcggcc
gatgcggcggccggtgccgaactgttcaccggcaaggccggctgcgccgcctgccacagg
ccgcccctctacagcgacggcatgttctacaacgtcggtctcgaggcaggcaaggcacag
cccgacctcggccgctttgcggtaagcaaggacccggccgacacatcggcgttcaagaca
ccgaccctgcgttcggtcggcatttccggtccctacttccacgacggcagcgtcgccagc
ctcgaagaagcagtccgctacatggccgctggaggcaaggcggatccgcacaagagccag
atcctgatcgaccgcaaactctccgagaaggagatcggccagctcgtcgctttcctcaac
acactgaccagcgaggaaagcttcgcgccgccgaagctgccgtaa

DBGET integrated database retrieval system