KEGG   Accumulibacter phosphatis: CAP2UW1_1153Help
Entry
CAP2UW1_1153      CDS       T00966                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
app  Accumulibacter phosphatis
Pathway
app00400  Phenylalanine, tyrosine and tryptophan biosynthesis
app01100  Metabolic pathways
app01110  Biosynthesis of secondary metabolites
app01130  Biosynthesis of antibiotics
app01230  Biosynthesis of amino acids
Module
app_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CAP2UW1_1153
Enzymes [BR:app01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CAP2UW1_1153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACV34484
JGI: CAP2UW11153
UniProt: C7RRJ5
Position
complement(1322440..1323228)
Genome map
AA seq 262 aa AA seqDB search
MSDILKRILAVKRDEVAAAQAALPLAEVRAMAERQPAARDFLGALRDRIVAGRPAVIAEI
KKASPSRGVLRADFRPAEVAASYQRHGAACLSVLTDHAFFQGAPEYLQAARAACSLPALR
KDFLVDAYQVHESRAMGADAILLIAAALDVPAMRDFEAIAGSLGMAVLVEVHNRQELDLA
LQLATPLLGINNRNLRSFDVSLQTTLELLPYIPAARIVVTESGILTTGDVQLMRDNGVNA
FLVGEACMRAVDPGEALAELFS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacattctcaaacggattctcgccgtcaagcgcgacgaagtcgccgcggcgcag
gccgccctaccgctcgccgaagtccgcgcgatggccgagaggcagccggcggcgcgcgat
tttctcggtgccctgcgcgacaggatcgtcgccggtcgcccggcggtcatcgccgagatc
aagaaggccagcccgtcacgcggggtactgcgcgccgactttcgcccggccgaagtcgcc
gccagctatcagcggcacggcgccgcctgcctgtcggtgctgaccgaccacgcgttcttt
cagggcgcgcccgagtacctgcaggcagcccgcgccgcctgcagcttgccggccttgcgc
aaggactttctggtagacgcctatcaggtccatgagtcacgcgccatgggcgccgacgcc
atcttgctgatcgctgccgcgctcgatgtgccggccatgcgcgacttcgaagccatcgcc
ggcagcctcggcatggccgttctcgtcgaagtgcacaaccgccaggaactcgatctcgcc
ctgcaactcgcgacgccgctgctcggcatcaacaaccgcaacctgcgcagcttcgacgtc
agcctgcagacgaccctcgaactgctgccctacatcccggccgcgcgtatcgtcgtcacc
gaaagcggcattctcactaccggtgatgttcagttgatgcgcgacaacggcgtcaatgcc
ttcctcgtcggcgaagcctgcatgcgcgcggtcgaccctggcgaggcgctcgccgaattg
ttttcctga

DBGET integrated database retrieval system