KEGG   Accumulibacter phosphatis: CAP2UW1_1180Help
Entry
CAP2UW1_1180      CDS       T00966                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
app  Accumulibacter phosphatis
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:app00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CAP2UW1_1180
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CAP2UW1_1180
Enzymes [BR:app01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CAP2UW1_1180
Two-component system [BR:app02022]
 CheA family
  CheA-CheYBV
   CAP2UW1_1180
Bacterial motility proteins [BR:app02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CAP2UW1_1180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1348433..1349530)
Genome map
AA seq 365 aa AA seqDB search
MSENTIKVTIVDDSALARQFIAQALSAAPGIEVLATAADPVIAFDRMRRQWPDVLVVDIE
MPRHDGMAFLREVMAERPTAIVICSALAARGTPANREAMTAGALAVITRPRIGLKAFLDT
AGGEIVRAVRAAARARVGTGPRVAAATPLLRPKNSADVMLAAGPPLAMPGNGEQIIAIGT
STGGTQALEAVLTRLPASCLGIVIVQHMPERFTAMLAQRLNELCRMEIREAQNGDRVMPG
RALIAPGGKHMLLKRSGTQYQVDVADGPLVNRHKPSVDVLFRSVARFAGANALGIIMTGM
GDDGARGLKEMHDAGARTIAQDEASCVVFGMPREAIKLGAVDQTMALDQIPGAVTAYCRT
GNPVA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaacacaatcaaggtaacgatcgtcgatgactcggcgctggctcgccagttc
atcgcccaggcgctgtcggctgcaccgggaatcgaggtgctcgccacggcggccgacccg
gtcatcgccttcgaccggatgcgcaggcaatggccggacgtgctggtcgtcgatatcgag
atgccgcgccacgacggcatggccttcctgcgcgaggtaatggccgaacggccgacggcc
atcgtcatctgctcggcgctcgccgcccggggaacgccggcgaaccgcgaggcgatgacg
gccggcgcgctcgccgtcatcacccggccaaggatcggcctcaaggctttcctcgacact
gccggcggcgagatcgtgcgtgccgtgcgcgccgccgcccgtgcccgcgtgggcacgggg
ccacgcgtcgccgcggcgaccccgctcctgcggccgaaaaactccgccgacgtgatgctc
gccgccggcccgccgctggccatgcccgggaacggcgagcagatcatcgccatcggcacg
tcgacgggtggcacgcaggcgctggaggcggttctcacgcggctgccggcaagctgtctc
ggcatcgtcatcgtccagcacatgcccgagcgcttcaccgcgatgctggcgcagcgcctc
aacgagctgtgccggatggaaatccgcgaggcgcagaacggcgaccgcgtcatgcccggg
cgagcgctgatcgcccccggcggcaagcacatgctgctcaagcgcagcggcactcaatat
caggtcgacgtcgccgacggcccgctggtgaaccgccacaaaccgtcggtcgatgtcctg
ttccgctcggtggccaggttcgccggcgccaacgcactcggcatcatcatgaccggcatg
ggcgacgatggcgcgcgcggcctcaaggagatgcacgacgcgggcgcccgcacgatcgcc
caggacgaagccagttgcgtggttttcggcatgcccagggaagccatcaagctgggcgcg
gtcgaccagacgatggcgctcgaccagattcccggcgccgtcaccgcctactgccggacc
ggcaacccggtcgcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system