KEGG   Accumulibacter phosphatis: CAP2UW1_1209Help
Entry
CAP2UW1_1209      CDS       T00966                                 

Definition
threonyl-tRNA synthetase
Orthology
K01868  
threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
app  Accumulibacter phosphatis
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:app00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1382924..1384840
Genome map
AA seq 638 aa AA seqDB search
MPIVTLPDGSQREFAQPVTVAEVAQSIGAGLARAALAGKIDGRLVDTSFRIDTDVHLGII
TEKDPEGLEVIRHSTAHLMAYAVKELFPAAQVTIGPVIENGFYYDFACERPFTLEDLAAI
EKRMTELARRDLLVQREVWQRDEAIAFFKSIGEHYKAELIDAIPPGQEVSLYREGDFVDL
CRGPHVPSTGKLKVFKLMKLAGAYWRGDHRNEQLQRIYGTAWTRKEDQDAYLHLLEEAEK
RDHRKLGRQLDLFHLQDEAPGMVFWHAKGWTIWQEVEQYMRRLLGENGYCEVKTPMIMDR
TLWERSGHWQNYAEHMFTTASENRDYAIKPMNCPGHIQIFNQGLRSYRDLPLRLAEFGSC
HRNEPSGALHGIMRVRAFVQDDAHIFCTEAQVLPETAAFIDLLEKIYADFGFTDILVKLS
TRPDKRIGSDAVWDRAEAALAEALAAKGLAYDLQPGEGAFYGPKIEFSLKDCLGRVWQCG
TLQLDFALPERLDAHYVGEDNDRHVPVMLHRAILGSLERFIGILIEHYAGAMPLWLSPMQ
VVVLNISEKQGDYAEQVAATLRRAGLRAEADLRNEKITRKIREHSLNKLPYQVVVGDKEV
AANLVAVRTRGGQDLGQMSLESLIRQLLEEVASRSGTA
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgccgattgtcacactgcctgacggttctcaacgggagttcgcgcagccggtcaccgtg
gccgaggtggcgcaaagcattggcgccggtctggcgcgcgcggccctcgccggcaagatt
gatggtcgtctggtcgatacctccttccgcatcgataccgacgtgcatctgggcatcatc
accgagaaggaccccgaaggtctcgaagtgatccggcactcgaccgcgcacctgatggct
tacgcggtcaaggaactcttcccggcggcgcaggtgacgattggcccggtgatcgaaaac
ggcttctactatgactttgcctgcgagcgcccgtttacgctcgaggatctggcggcgatc
gaaaagcggatgaccgaactcgcccgccgcgatctgctcgtgcagcgggaagtttggcag
cgcgatgaggccatcgctttcttcaagtcgatcggcgagcactacaaggccgagttgatc
gatgccattccgcccggccaggaagtgtcgctctatcgcgagggtgatttcgtcgacctc
tgtcgcggcccgcacgtaccgtcgacaggcaaactgaaggtgttcaagctgatgaagctg
gcgggtgcctactggcgcggcgatcatcgcaacgagcagctgcagcggatctacggtacc
gcctggactcggaaggaagatcaggacgcctacctgcacctgctcgaggaggcggaaaag
cgcgaccatcgcaagctggggcggcaactggatctgttccacctgcaggacgaggcaccg
ggaatggtcttctggcacgccaaagggtggacgatctggcaggaagttgagcagtacatg
cgtcgtctgcttggcgagaacggttattgtgaagtcaagacgccgatgatcatggaccgc
acgttgtgggagcgctcgggccattggcagaactatgccgagcacatgttcaccacggcg
tccgagaaccgcgactacgcgatcaagccgatgaattgtcccggccacatccagatcttc
aatcagggtttgcgcagctatcgggacctgccgttgcggctggccgagttcggctcgtgt
catcgtaacgagccttccggcgctctgcacggcatcatgcgtgtacgcgctttcgtgcag
gatgacgcccacattttctgtacagaagcgcaggttctgccggaaacggcggccttcatc
gatcttctggaaaagatctatgccgatttcgggttcaccgacatcctcgtcaagctgtcg
acacgcccggacaaacgcatcggttccgatgcggtgtgggacagggcggaagcggctctt
gccgaggcgctggctgccaagggcctggcctacgatctgcaaccgggagagggcgccttt
tacggtccgaagatcgagttttcactcaaggactgtctcgggcgggtctggcagtgcggc
accttgcagcttgatttcgccttgccggaacgcctcgacgcgcactatgtcggcgaagac
aacgaccgccacgttcccgtcatgctgcaccgggcgatcctcggttcgctcgagcgtttc
atcggtattctcatcgaacactatgctggcgccatgcctttgtggctgtcgccgatgcag
gtcgtggtactgaatatctccgagaaacaaggcgactatgccgaacaggtggcggcgacg
cttcgccgcgccggcctgcgcgccgaagcggatttgcgcaacgaaaaaattacccgtaaa
attcgggaacatagcttgaacaagctgccctatcaggtcgtcgttggcgacaaggaagtg
gcagccaatctggtggccgtgcgcacacgcggtgggcaggatctggggcaaatgtcgctc
gagtccctgatccggcaacttctcgaggaagttgcgtcgcgtagtggcacggcttga

DBGET integrated database retrieval system