KEGG   Accumulibacter phosphatis: CAP2UW1_1209Help
Entry
CAP2UW1_1209      CDS       T00966                                 

Definition
threonyl-tRNA synthetase
Orthology
K01868  
threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
app  Accumulibacter phosphatis
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:app00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    CAP2UW1_1209
Enzymes [BR:app01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     CAP2UW1_1209
Amino acid related enzymes [BR:app01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   CAP2UW1_1209
Transfer RNA biogenesis [BR:app03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CAP2UW1_1209
 Prokaryotic Type
    CAP2UW1_1209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1382924..1384840
Genome map
AA seq 638 aa AA seqDB search
MPIVTLPDGSQREFAQPVTVAEVAQSIGAGLARAALAGKIDGRLVDTSFRIDTDVHLGII
TEKDPEGLEVIRHSTAHLMAYAVKELFPAAQVTIGPVIENGFYYDFACERPFTLEDLAAI
EKRMTELARRDLLVQREVWQRDEAIAFFKSIGEHYKAELIDAIPPGQEVSLYREGDFVDL
CRGPHVPSTGKLKVFKLMKLAGAYWRGDHRNEQLQRIYGTAWTRKEDQDAYLHLLEEAEK
RDHRKLGRQLDLFHLQDEAPGMVFWHAKGWTIWQEVEQYMRRLLGENGYCEVKTPMIMDR
TLWERSGHWQNYAEHMFTTASENRDYAIKPMNCPGHIQIFNQGLRSYRDLPLRLAEFGSC
HRNEPSGALHGIMRVRAFVQDDAHIFCTEAQVLPETAAFIDLLEKIYADFGFTDILVKLS
TRPDKRIGSDAVWDRAEAALAEALAAKGLAYDLQPGEGAFYGPKIEFSLKDCLGRVWQCG
TLQLDFALPERLDAHYVGEDNDRHVPVMLHRAILGSLERFIGILIEHYAGAMPLWLSPMQ
VVVLNISEKQGDYAEQVAATLRRAGLRAEADLRNEKITRKIREHSLNKLPYQVVVGDKEV
AANLVAVRTRGGQDLGQMSLESLIRQLLEEVASRSGTA
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgccgattgtcacactgcctgacggttctcaacgggagttcgcgcagccggtcaccgtg
gccgaggtggcgcaaagcattggcgccggtctggcgcgcgcggccctcgccggcaagatt
gatggtcgtctggtcgatacctccttccgcatcgataccgacgtgcatctgggcatcatc
accgagaaggaccccgaaggtctcgaagtgatccggcactcgaccgcgcacctgatggct
tacgcggtcaaggaactcttcccggcggcgcaggtgacgattggcccggtgatcgaaaac
ggcttctactatgactttgcctgcgagcgcccgtttacgctcgaggatctggcggcgatc
gaaaagcggatgaccgaactcgcccgccgcgatctgctcgtgcagcgggaagtttggcag
cgcgatgaggccatcgctttcttcaagtcgatcggcgagcactacaaggccgagttgatc
gatgccattccgcccggccaggaagtgtcgctctatcgcgagggtgatttcgtcgacctc
tgtcgcggcccgcacgtaccgtcgacaggcaaactgaaggtgttcaagctgatgaagctg
gcgggtgcctactggcgcggcgatcatcgcaacgagcagctgcagcggatctacggtacc
gcctggactcggaaggaagatcaggacgcctacctgcacctgctcgaggaggcggaaaag
cgcgaccatcgcaagctggggcggcaactggatctgttccacctgcaggacgaggcaccg
ggaatggtcttctggcacgccaaagggtggacgatctggcaggaagttgagcagtacatg
cgtcgtctgcttggcgagaacggttattgtgaagtcaagacgccgatgatcatggaccgc
acgttgtgggagcgctcgggccattggcagaactatgccgagcacatgttcaccacggcg
tccgagaaccgcgactacgcgatcaagccgatgaattgtcccggccacatccagatcttc
aatcagggtttgcgcagctatcgggacctgccgttgcggctggccgagttcggctcgtgt
catcgtaacgagccttccggcgctctgcacggcatcatgcgtgtacgcgctttcgtgcag
gatgacgcccacattttctgtacagaagcgcaggttctgccggaaacggcggccttcatc
gatcttctggaaaagatctatgccgatttcgggttcaccgacatcctcgtcaagctgtcg
acacgcccggacaaacgcatcggttccgatgcggtgtgggacagggcggaagcggctctt
gccgaggcgctggctgccaagggcctggcctacgatctgcaaccgggagagggcgccttt
tacggtccgaagatcgagttttcactcaaggactgtctcgggcgggtctggcagtgcggc
accttgcagcttgatttcgccttgccggaacgcctcgacgcgcactatgtcggcgaagac
aacgaccgccacgttcccgtcatgctgcaccgggcgatcctcggttcgctcgagcgtttc
atcggtattctcatcgaacactatgctggcgccatgcctttgtggctgtcgccgatgcag
gtcgtggtactgaatatctccgagaaacaaggcgactatgccgaacaggtggcggcgacg
cttcgccgcgccggcctgcgcgccgaagcggatttgcgcaacgaaaaaattacccgtaaa
attcgggaacatagcttgaacaagctgccctatcaggtcgtcgttggcgacaaggaagtg
gcagccaatctggtggccgtgcgcacacgcggtgggcaggatctggggcaaatgtcgctc
gagtccctgatccggcaacttctcgaggaagttgcgtcgcgtagtggcacggcttga

DBGET integrated database retrieval system