KEGG   Accumulibacter phosphatis: CAP2UW1_1230Help
Entry
CAP2UW1_1230      CDS       T00966                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
app  Accumulibacter phosphatis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:app01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:app00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:app00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1408373..1409578
Genome map
AA seq 401 aa AA seqDB search
MTQPDYDLPDATGHFGQYGGVFVAETLIGALDELKEAYAAAQRDPQFVAEFDYDLRHYVG
RPSPLYHARRWSEVLGGAQIYLKREDLNHTGAHKINNCIGQAMLARRMHKPRVIAETGAG
QHGVATATVAARYGMECVVYMGSEDIRRQAANVYRMKLLGATVVPVESGSRTLKDALNEA
MRDWVTNVSNTFYIIGTVAGPHPYPMMVRDFQSVIGREAIAQMQEQCGRQPDAVIACVGG
GSNAMGIFHPYIPVAGVRLIGVEAAGEGIATGRHAASLTAGRPGVLHGNRTYLLQDQDGQ
IIETHSISAGLDYPGVGPEHAWLKDSGRAEYVGVSDSEALQAFHDLCRLEGIIPALESSH
ALAYASRLAPTLPQDRILLVNLSGRGDKDMHTVAEKSGITF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcctgactacgatttacccgacgccacaggccattttggccagtacggtggc
gtcttcgtcgccgaaaccctgatcggtgcactcgacgaactcaaggaggcttacgccgcc
gctcagcgcgatcctcaattcgtcgccgaattcgattacgacctcagacactatgtcggt
cggccaagtccgctctaccatgcgcggcggtggtcggaggtactcggcggcgcccagatc
tatctcaaacgcgaagacctgaatcacaccggtgcccacaagatcaacaactgcatcggt
caggcgatgctggcgcggcggatgcataaaccacgcgtcatcgccgagacgggtgccggt
cagcatggtgtcgcaacggcgaccgtcgccgcgcgctatggcatggaatgcgttgtctac
atgggttcggaagatatcagacggcaagccgccaacgtctaccggatgaaactgctcggc
gcgaccgtcgtgccggtcgagagtggttcaaggacgctcaaggacgcgttgaatgaagca
atgcgcgactgggtcaccaatgtctccaacacgttctacatcatcggtacggtggccggc
ccgcatccctatccgatgatggtgcgcgattttcagtcggtcatcggccgcgaggcgatc
gcccaaatgcaggagcagtgcggccgtcaacccgacgccgtgattgcctgcgtcggcggt
ggctcgaacgcgatgggcattttccacccctatattccggttgccggtgtgcgtctgatc
ggcgtcgaggcggccggcgaaggcatcgcgacgggacggcatgcggcctcgttgacggca
gggcggccaggcgtgctgcacggtaaccggacctatctgctgcaggatcaggacggtcag
atcatcgagacgcattcgatttcggccggcctcgattatccgggcgtcggcccggagcac
gcctggctcaaggatagcggccgggcggagtatgtcggagtcagcgatagcgaggcgctg
caggcctttcacgatctgtgtcgcctcgaaggcatcattccggcgctcgaatcgagccat
gccctggcctacgccagccgattggcgccgaccttgccgcaggacaggatactgctggtc
aacctctccggtcgtggtgacaaggacatgcacaccgttgccgaaaaatcgggaatcacc
ttctga

DBGET integrated database retrieval system