KEGG   Accumulibacter phosphatis: CAP2UW1_1230Help
Entry
CAP2UW1_1230      CDS       T00966                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
app  Accumulibacter phosphatis
Pathway
app00260  Glycine, serine and threonine metabolism
app00400  Phenylalanine, tyrosine and tryptophan biosynthesis
app01100  Metabolic pathways
app01110  Biosynthesis of secondary metabolites
app01130  Biosynthesis of antibiotics
app01230  Biosynthesis of amino acids
Module
app_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAP2UW1_1230
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CAP2UW1_1230
Enzymes [BR:app01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CAP2UW1_1230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACV34558
JGI: CAP2UW11230
UniProt: C7RRR9
Position
1408373..1409578
Genome map
AA seq 401 aa AA seqDB search
MTQPDYDLPDATGHFGQYGGVFVAETLIGALDELKEAYAAAQRDPQFVAEFDYDLRHYVG
RPSPLYHARRWSEVLGGAQIYLKREDLNHTGAHKINNCIGQAMLARRMHKPRVIAETGAG
QHGVATATVAARYGMECVVYMGSEDIRRQAANVYRMKLLGATVVPVESGSRTLKDALNEA
MRDWVTNVSNTFYIIGTVAGPHPYPMMVRDFQSVIGREAIAQMQEQCGRQPDAVIACVGG
GSNAMGIFHPYIPVAGVRLIGVEAAGEGIATGRHAASLTAGRPGVLHGNRTYLLQDQDGQ
IIETHSISAGLDYPGVGPEHAWLKDSGRAEYVGVSDSEALQAFHDLCRLEGIIPALESSH
ALAYASRLAPTLPQDRILLVNLSGRGDKDMHTVAEKSGITF
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcctgactacgatttacccgacgccacaggccattttggccagtacggtggc
gtcttcgtcgccgaaaccctgatcggtgcactcgacgaactcaaggaggcttacgccgcc
gctcagcgcgatcctcaattcgtcgccgaattcgattacgacctcagacactatgtcggt
cggccaagtccgctctaccatgcgcggcggtggtcggaggtactcggcggcgcccagatc
tatctcaaacgcgaagacctgaatcacaccggtgcccacaagatcaacaactgcatcggt
caggcgatgctggcgcggcggatgcataaaccacgcgtcatcgccgagacgggtgccggt
cagcatggtgtcgcaacggcgaccgtcgccgcgcgctatggcatggaatgcgttgtctac
atgggttcggaagatatcagacggcaagccgccaacgtctaccggatgaaactgctcggc
gcgaccgtcgtgccggtcgagagtggttcaaggacgctcaaggacgcgttgaatgaagca
atgcgcgactgggtcaccaatgtctccaacacgttctacatcatcggtacggtggccggc
ccgcatccctatccgatgatggtgcgcgattttcagtcggtcatcggccgcgaggcgatc
gcccaaatgcaggagcagtgcggccgtcaacccgacgccgtgattgcctgcgtcggcggt
ggctcgaacgcgatgggcattttccacccctatattccggttgccggtgtgcgtctgatc
ggcgtcgaggcggccggcgaaggcatcgcgacgggacggcatgcggcctcgttgacggca
gggcggccaggcgtgctgcacggtaaccggacctatctgctgcaggatcaggacggtcag
atcatcgagacgcattcgatttcggccggcctcgattatccgggcgtcggcccggagcac
gcctggctcaaggatagcggccgggcggagtatgtcggagtcagcgatagcgaggcgctg
caggcctttcacgatctgtgtcgcctcgaaggcatcattccggcgctcgaatcgagccat
gccctggcctacgccagccgattggcgccgaccttgccgcaggacaggatactgctggtc
aacctctccggtcgtggtgacaaggacatgcacaccgttgccgaaaaatcgggaatcacc
ttctga

DBGET integrated database retrieval system