KEGG   Accumulibacter phosphatis: CAP2UW1_1231Help
Entry
CAP2UW1_1231      CDS       T00966                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
app  Accumulibacter phosphatis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CAP2UW1_1231
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAP2UW1_1231
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CAP2UW1_1231
Enzymes [BR:app01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CAP2UW1_1231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1409581..1410399
Genome map
AA seq 272 aa AA seqDB search
MSKIQAVFERLQARGRKALIPFITAGDPAPELTVPLLHTLVQAGADIIELGVPFSDPMAD
GPTIQRASERALAKGVSLRHVLGMVANFRADDNETPIVLMGYANPIESMGLEAFAAASFD
AGVDGVLVVDYPPEEAVEFAQTLHRHALDPIFLLAPTSSEARMTQVGALASGYIYYVSLK
GVTGSAALDVAAVAARIPEIRARTGVPVGVGFGIRDAATAAAVAELADAVVIGSRIIEEI
EQSPSDKVCVNVGTLVDAIRRAMDAAVSRGQA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaatacaggctgtattcgaacgcctccaggcgcgcgggcgcaaggcgctgatt
ccgttcatcactgcgggagatccggcgccggagctgaccgtaccgctgctgcatacgctg
gtgcaagcgggggccgacatcatcgaacttggcgtcccgttctccgacccgatggctgat
ggaccaaccatccagcgtgcctccgagcgagcgctggcgaagggcgtgagtctgcgccac
gtacttgggatggtggccaattttcgcgccgacgacaacgaaacaccaatcgtgctcatg
ggctacgccaatccgatcgagtcgatgggtcttgaagcctttgccgcggcctcgtttgat
gccggtgtggacggcgtcctggtcgttgactatccacccgaggaagctgtcgagttcgca
cagaccttgcaccggcacgcgctcgatccgatcttcctgttggcgccgacatccagcgag
gcgcgcatgacgcaggtcggtgcgctggccagcggctacatctactacgtgtcgctgaag
ggcgttaccggctcggcggcgctggatgttgcggccgtcgccgcacgcattccggagatc
cgcgcacgcaccggcgttcccgtcggcgttggtttcggcatccgtgatgcggcgacagcg
gcggcagtcgcggaactggccgatgcggtcgtcatcggtagccggatcatcgaagaaatc
gaacagtcgccgtccgacaaggtgtgtgtcaacgtcggcaccctggtggacgccattcgc
cgtgcgatggatgccgcggtgtcgcgaggacaagcatga

DBGET integrated database retrieval system