KEGG   Accumulibacter phosphatis: CAP2UW1_1364Help
Entry
CAP2UW1_1364      CDS       T00966                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
app  Accumulibacter phosphatis
Brite
Enzymes [BR:app01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     CAP2UW1_1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_12 NodS Methyltransf_23 MTS RrnaAD
Motif
Other DBs
NCBI-ProteinID: ACV34688
JGI: CAP2UW11364
UniProt: C7RSH5
Position
1548349..1549005
Genome map
AA seq 218 aa AA seqDB search
MSGAVSGFGMTSQRTRTRMIERLREQGIVDEEVLAAIAAVPRHIFVEEALASRAYEDTAL
PLGFSQTISQPYVVARMIAALRAGRQLGRTLEIGAGCGYQAAVLAQLTDEVYAIERIEPL
LAKARINLRAIKQLKVRLKHADGQLGLPEAAPFDTIIVAAAASRVPPALLRQLAPGGRMI
LPVGGATQYLALIEHRTEGYVETRLDAVRFVPLLSGVE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgccgtttccggtttcggcatgacctcgcagcgcacgcgcacgcgcatgatc
gagcggttgcgcgagcaggggatcgtcgacgaggaggtgctggcggcgatcgccgcggtg
ccgcggcacatcttcgtcgaagaggcgctggcctcgcgcgcctacgaggatacggcgctg
ccgctcggcttttcgcagacgatctcgcaaccctacgtggtggcgcgaatgatcgcagcg
ctgcgcgccggtcgccagctcggcaggacgctcgagatcggtgccggctgtggctaccaa
gcggccgttctcgcccagttgacggacgaagtctacgcgatcgagcgcatcgagccgctg
ctcgccaaggcgaggatcaacctgcgtgccatcaagcaactcaaggtgcgtctgaagcac
gccgacggccagctcggcctgcccgaggcggcgccattcgacacgatcatcgtcgccgcg
gcggcgtcgcgggtgccaccggcgctgttgcgccaactggcgccaggcggtcggatgatc
ctgccggtgggtggggcgacgcagtacctggccctgatcgaacaccgcaccgaggggtat
gtcgaaacgcgtctcgacgccgttcgttttgttccgctactttcgggagtcgaatga

DBGET integrated database retrieval system