KEGG   Accumulibacter phosphatis: CAP2UW1_1512Help
Entry
CAP2UW1_1512      CDS       T00966                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
app  Accumulibacter phosphatis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CAP2UW1_1512
Enzymes [BR:app01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CAP2UW1_1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1715546..1717072)
Genome map
AA seq 508 aa AA seqDB search
MTSLPRQSGILLHPTSLPGPHGSGDLGPAAYHFVDWLVAAGQSLWQVLPLGSVGPGNSPY
ISPSAFAGNELLIDLSQLRDAGWLTDVDLASVPEFPETRVDYASVRDFRVARLRRAAKRF
FGRKNTPEQSAFEAFCSAARDWLDDYALFMALDIAHGGNGRMWQDWPAPLAQRQPVALKE
ALLKYADEMKFWKFCQWRFHDQWAKLKDYANARHIEIVGDLPIFVAAHSADVWSNPGLFD
LDKKGRPRVVAGVPPDYFSATGQRWGNPLYRWPAHAAEGYRWWIERMRQTMKLCDVVRID
HFRGFESFWEIPATAKTAIDGKWRPGPGEAVFAAMRRELGDAQGRLRIIAEDLGIITPEV
NALREAIGLPGMRILQFAFDGDANNLYLPHNYDANTVVYTGTHDNDTTLGWWKSLRPSER
DHIINYLGGGAEARAEPQWHLIRLANSSVAALCVIPMQDVLGLDSTHRMNQPSLSEGSWE
WRFTWKWVDASHAHRLAELARLYGRHRA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacttccccgccagagcggcattctccttcaccccacttcactccccggtccg
catggctcgggcgacctcggcccggccgcctaccactttgtcgactggctggtcgccgcc
ggccaatcgctctggcaggtgctgccactcggcagcgtcggaccgggcaactccccctac
atcagcccgtcggctttcgccggcaacgaactgttgatcgacctgtcgcaactgcgcgac
gccggttggctgaccgacgtcgacctggcgtcggtccccgaattccctgaaacccgggtc
gattatgcgagcgtgcgggactttcgcgtcgcgcgcttgcggcgcgcggccaagcggttc
ttcggccgcaagaacacgccggaacagagcgccttcgaagctttctgcagcgcggccagg
gactggctcgacgactacgccctgttcatggcgctcgacatcgcccatggcggcaatggc
aggatgtggcaggactggcccgcgccgctggcccagcggcagcccgttgcgctcaaggaa
gccctcctcaagtacgccgacgaaatgaagttctggaaattctgccagtggcgcttccac
gaccaatgggcgaagctgaaggactacgccaacgctcggcacatcgagatcgtcggcgac
ctgccgattttcgtcgccgcacacagcgccgatgtctggtcgaatccaggactgttcgat
ctcgacaagaagggccggccgcgcgtggtcgccggcgtaccgccggattacttcagtgcc
accggccagcgctggggcaacccgctgtaccgctggcccgcacacgctgccgagggctat
cgctggtggatcgagcgaatgcggcagacgatgaaactctgcgatgtcgtccgcatcgac
cactttcgtggcttcgagtcgttctgggagattccggccaccgccaagacggcaatcgac
ggcaaatggcggcccgggccgggagaagccgtgtttgcggccatgcgccgcgaactgggt
gatgcgcagggcaggctgcgcatcatcgccgaggatctcggcattatcactcccgaggtc
aacgcgctgcgcgaggcgatcggtttgccgggcatgcgcatcctgcagttcgccttcgac
ggtgacgccaacaacctctacctgccgcacaactacgacgccaacaccgtcgtgtatacc
ggaacccatgacaacgacacgacccttggctggtggaagtcactgaggccgtcggagcgc
gaccacataatcaactacctcggcggcggcgccgaggcccgggcagagccacagtggcat
ctgatccgccttgccaattcctcggtggccgcactctgcgtcatcccgatgcaggacgtg
ctcggactcgactcgacgcaccgcatgaatcaaccgagcctcagcgaaggctcgtgggag
tggcgcttcacgtggaagtgggtggacgcatcgcacgcgcatcggcttgcggaactggcg
cgcctgtacggccgccatcgcgcctga

DBGET integrated database retrieval system