KEGG   Accumulibacter phosphatis: CAP2UW1_1635Help
Entry
CAP2UW1_1635      CDS       T00966                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
app  Accumulibacter phosphatis
Pathway
app00010  Glycolysis / Gluconeogenesis
app00071  Fatty acid degradation
app00350  Tyrosine metabolism
app00625  Chloroalkane and chloroalkene degradation
app00626  Naphthalene degradation
app01100  Metabolic pathways
app01110  Biosynthesis of secondary metabolites
app01120  Microbial metabolism in diverse environments
app01130  Biosynthesis of antibiotics
app01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAP2UW1_1635
  Lipid metabolism
   00071 Fatty acid degradation
    CAP2UW1_1635
  Amino acid metabolism
   00350 Tyrosine metabolism
    CAP2UW1_1635
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CAP2UW1_1635
   00626 Naphthalene degradation
    CAP2UW1_1635
Enzymes [BR:app01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CAP2UW1_1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ACV34949
JGI: CAP2UW11635
UniProt: C7RTX3
Position
complement(1860487..1861494)
Genome map
AA seq 335 aa AA seqDB search
MKAMILDAQGQPLRLAEVPRPKPGADQVLLEVRACGVCRTDLHVMDGDLRQPRLPLVLGH
EIVGVIVDKGAEVQRFALGQRIGVPWLGRTCGHCRYCSSGAENLCDAAEFTGYTLDGGYA
EFALADQNYCFALPDTYSDAEAAPLLCAGLIGYRSLVAAGDARHLGIYGFGAAAHIIAQV
ARWQGREVFAFTKPGDVEGQAFARQLGAAWAGGADAAPPREMDAAILFAPVGDLVPQALR
HTVKGGTVVCAGIHMSNIPEFPYSILWGERCIRSIANLTRRDGEEFFAVAPRAGVRTEVE
CFPLESANEALHRLRIGQIRGAAVLVAGQDTSQKL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatgattctggatgcgcagggccagcccttgcggctggccgaagtgcctcgg
ccaaaacccggtgccgatcaggtcctgctcgaggtacgcgcctgcggcgtctgccgcacc
gacctgcacgtcatggacggcgatctgcgacaaccgcgactgccgctggtgctcggccac
gagatcgtcggcgtgatcgtcgacaagggcgccgaggtgcagcgattcgcgcttggccag
cgcatcggcgtcccctggctcggacgcacctgcggccattgccgttactgcagcagcggc
gccgagaacctttgcgacgcggcggagttcaccggctacacgctcgacggcggctacgcc
gaattcgcgctcgccgatcagaactactgcttcgccctgcctgacacttattccgacgcc
gaggcggcaccgctgctctgcgccgggctgatcggttaccgctcgctggttgccgccggc
gacgcgcggcacctcggcatctacggtttcggcgcggccgcgcacatcatcgcgcaggtg
gctcgctggcagggacgcgaggtcttcgccttcaccaagccgggcgatgtcgaaggccag
gcttttgcccgccagctcggcgcggcctgggccggcggagccgacgcggcgccacctcgg
gaaatggacgcggcgatcctcttcgcaccggtcggcgacctggtgccgcaagcgcttcgc
cacacggtcaagggcggcaccgtggtctgcgccggcatccacatgagcaacattcccgag
ttcccctactcgattctctggggagagcgctgcatccgctcgatcgccaacctgacccgg
cgcgatggtgaggagttcttcgccgttgcgccccgggccggtgtcaggacggaagtggag
tgttttcccctcgaatcggccaacgaggcgctgcacaggctgcgaattggccagatccgt
ggcgccgccgttctcgttgccggccaggacacgtctcagaaactgtag

DBGET integrated database retrieval system