KEGG   Accumulibacter phosphatis: CAP2UW1_1733Help
Entry
CAP2UW1_1733      CDS       T00966                                 

Definition
phosphodiesterase/alkaline phosphatase D-like protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
app  Accumulibacter phosphatis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CAP2UW1_1733
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CAP2UW1_1733
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CAP2UW1_1733
Enzymes [BR:app01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CAP2UW1_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1957518..1958519
Genome map
AA seq 333 aa AA seqDB search
MRIAFTSCFDVLDDPEQVVWDRVAAQRPDVMLLLGDSIYMDFGVNLPLLGVHSTHPLGKP
RKWDEAKFAQEMYSRYRAQSEVNSFRSLVGSVGIIGAIWDDHDFAWNDSWGAGFDEDVVP
RNKKLIARTLHLQFRDWLQKRPLVEYPAIPSMDSLLSTEDRGIEYSFSIGPVLFLMLDGR
YYREKQREVPSPYPEIHPGEPLATMLGEAQKGWLAQTINDQDGLSVICSGSTLTDRNVNG
ADSWDRYTDFEWLLGQEFEQTVVLSGDIHDIRLKKHKKTGGGNLWEFTASGAARPGKFHG
ASGNFGIVDVDGRSITVQLFDEDGLRSKKVIDF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgcttttacgtcctgcttcgatgtgctcgatgacccagagcaagtggtatgg
gaccgagttgctgcgcagagacccgatgtcatgttgctccttggagattccatttacatg
gattttggcgtcaatctcccgctcctaggcgtccattcaacgcatccactgggaaagcca
agaaagtgggatgaggcgaagtttgcgcaggagatgtacagccgctaccgggcgcaatcg
gaagtgaacagtttccggagccttgttggctctgtcggcatcattggagccatctgggac
gatcacgattttgcctggaacgattcatggggtgcaggattcgacgaagacgtggttccc
aggaacaagaaactgatagccagaacattacacctgcagtttcgcgattggttgcagaag
cggcccctggtagagtatccagcgataccgtcgatggattctttgctcagcacggaagac
cgcggaatagaatactcattttcgatcggcccggtgctttttctcatgctcgatggccgg
tactaccgcgaaaagcagcgtgaggtaccaagtccatacccggagattcacccgggagag
cccttggcaacgatgcttggcgaagcgcagaaaggctggctcgcacaaacgattaacgat
caggatggcctcagcgtgatctgctccggttccactttgacggaccgaaatgtgaacggt
gccgacagttgggaccgttacaccgacttcgagtggcttcttggccaggagttcgagcaa
accgttgtcttgtcgggcgatattcacgatattcgtctgaagaagcataagaagacgggg
ggcggcaatttgtgggaattcaccgcatctggtgccgcccgccctggcaagtttcacggt
gccagcggcaatttcggcattgtcgatgtagatggcagaagtatcacggttcaacttttc
gatgaggatggcctccgttccaaaaaagtgattgatttttga

DBGET integrated database retrieval system