KEGG   Accumulibacter phosphatis: CAP2UW1_1839Help
Entry
CAP2UW1_1839      CDS       T00966                                 

Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
app  Accumulibacter phosphatis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAP2UW1_1839
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAP2UW1_1839
   00020 Citrate cycle (TCA cycle)
    CAP2UW1_1839
   00620 Pyruvate metabolism
    CAP2UW1_1839
Enzymes [BR:app01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CAP2UW1_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2069978..2071624
Genome map
AA seq 548 aa AA seqDB search
MSQLIEVKVPDIGDYTDVPVIDICVIVGDVVKVDDALVTLESDKATMDVPSSAAGVVKEI
RVALGEKISEGTVVVVLEASEVRAAAPAAAVSAASPATVPAAAVTAPVPAAASGGGTVEV
KVPDIGDYHDVPVIDVCVKVGDVVKVDDALVTLESDKATMDVPSSAAGVIREIRVGLGDK
VSAGAVVVVLDTAGSAAAPTAAAAAPVTAAATAAPATGGVAPPPAPAAMLAAAPVPALAP
GARMHASPSVRMLARELGVDLNKVTASGPKARILKEDVTAYVKGVLSAPAVAAAAPSLGG
GLDLLPWPKMDFAKYGAVEVKPLARIKKISAQNLARNWVMIPAVTYHEDADITDLEAFRV
AMNKENEKSAQSGGLKITMLAFLIKACAVALKKFPEFNSSLDGDNLVLKQYCHVAFAADT
PNGLVVPVIRNADQKSVSQLAVESGELARKARDGKLTPGEMSGACFTISSLGGIGGTHFS
PIVNAPEVAILGVNRSVMKPVWNGKEFAPRLILPMSLSADHRVIDGALATRFNVFVAQLL
ADMRRVLL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaattgatcgaagtgaaagtccccgatatcggcgattacaccgatgtgccggtg
atcgacatctgtgtcatcgtcggcgacgtggtcaaggtcgacgatgccctggtgaccctc
gaatccgacaaggcgacgatggacgtgccgtcgtcggcagccggtgtggtaaaggaaatc
cgcgttgcgctgggcgagaagatctcggaaggcacggtcgtcgttgtcctcgaagcgtcc
gaggtaagggccgcggcgcctgcggcggccgtctcggccgcttctccggccactgttccg
gcggcagccgtcaccgccccggtgccggcggcggcgagcggcggcgggacggtcgaggtc
aaggtaccggatatcggtgactaccacgacgtgccggtgatcgacgtctgcgtcaaggtc
ggcgacgtcgtcaaggtggacgatgccctggtcacgctcgaatccgacaaggcgacgatg
gacgtgccctcgtcggcggccggggtgatccgcgagatcagggtcggactcggcgacaag
gtgtctgcgggcgcggtcgtcgtcgtccttgacaccgctgggagcgctgccgcccctact
gctgctgccgccgctcccgtgactgccgccgcgacggcagcaccggcgaccggcggcgtt
gcaccgccgcccgcgccagcggctatgctggccgctgcgccggtcccagcgctggcgccc
ggtgccagaatgcacgccagcccgtcggtacgtatgctggcgcgcgaactcggtgtcgat
ctgaacaaggtgactgccagcggacccaaggcccgcatcctcaaggaggatgtgacggcc
tacgtcaagggcgtcctgagcgccccggccgtggccgccgcggcaccttcgctcggcggt
gggctcgacctcctgccgtggccgaagatggacttcgccaaatacggtgcggtcgaagtc
aagccactggcgcgcatcaagaagatctccgcgcagaacctggcgcgcaactgggtgatg
atcccggcggtcacctaccacgaggacgccgacatcaccgatctcgaagccttccgcgtc
gccatgaacaaggagaacgagaagtcggcccagtctggtggtctcaagatcaccatgctt
gctttcctgatcaaggcctgtgccgtggcactgaagaagttccccgagttcaacagctcg
ctcgatggtgacaatctggtgctcaagcagtattgccacgtcgctttcgccgccgacacg
ccgaacggcctcgtcgtgccggtgatcaggaacgccgaccagaagtcggtgagccaactc
gccgtcgaaagcggcgaactggcgagaaaggcacgcgacggcaagctcacgccgggggag
atgtccggtgcctgcttcaccatttccagcctcggtggcatcggcggcacgcacttctcg
ccgatcgtcaatgcgccggaagtcgccatcctcggggtgaaccggtcggtgatgaagccg
gtctggaacggcaaggagttcgcgccgcgcctgatcctgccgatgtcgctgtcggccgac
caccgcgtcatcgacggtgcgctggcgacgcgtttcaacgtatttgttgcgcaactgctt
gccgacatgcggcgcgtgctgctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system